 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Zpz_sc03722.1.g00030.1.am.mk |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
Family |
ZF-HD |
Protein Properties |
Length: 101aa MW: 10505.4 Da PI: 5.5524 |
Description |
ZF-HD family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Zpz_sc03722.1.g00030.1.am.mk | genome | ZGD | View Nucleic Acid |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | ZF-HD_dimer | 100 | 1.7e-31 | 27 | 83 | 3 | 60 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
+v+Y+eC++NhAas+Gg+avDGC+Efm+ g+egta+al+CaAC CHR+FHRrev+ee
Zpz_sc03722.1.g00030.1.am.mk 27 AVHYRECQRNHAASIGGYAVDGCREFMAL-GAEGTAEALTCAACSCHRSFHRREVDEE 83
799*************************9.999*********************9876 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009640 | Biological Process | photomorphogenesis |
GO:0009733 | Biological Process | response to auxin |
GO:0009735 | Biological Process | response to cytokinin |
GO:0009737 | Biological Process | response to abscisic acid |
GO:0009739 | Biological Process | response to gibberellin |
GO:0009741 | Biological Process | response to brassinosteroid |
GO:0043392 | Biological Process | negative regulation of DNA binding |
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated |
GO:0048509 | Biological Process | regulation of meristem development |
GO:0005634 | Cellular Component | nucleus |
GO:0005737 | Cellular Component | cytoplasm |
GO:0003677 | Molecular Function | DNA binding |
GO:0042803 | Molecular Function | protein homodimerization activity |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, such as ZHD5, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by preventing the expression of genes involved in gibberellic acid (GA), auxin and brassinosteroid signaling and by promoting the expression of abscisic acid (ABA)-responsive genes. Regulates several development aspects, including photomorphogenesis, apical dominance, longevity, flower morphology and fertility, as well as root and stem elongation. Promotes the formation of ectopic shoot meristems on leaf margins. {ECO:0000269|PubMed:16412086, ECO:0000269|PubMed:21059647, ECO:0000269|PubMed:21455630}. |