![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc03307.1.g00060.1.sm.mkhc | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 222aa MW: 24879.1 Da PI: 6.6916 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 86.5 | 1.6e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krie+ rqvtfskRr g++KKAeELSvLCda+va+i+fsstgkl ++s Zpz_sc03307.1.g00060.1.sm.mkhc 9 KRIESAAARQVTFSKRRRGLFKKAEELSVLCDADVALIVFSSTGKLSQFAS 59 79*********************************************9986 PP | |||||||
2 | K-box | 56.5 | 1.2e-19 | 90 | 171 | 18 | 99 |
K-box 18 qqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 + ++a+L++++ + +R++ Ge+Le Ls++eLq+Le++Le +l ++ ++K++ +leqi++lq+k +l een++Lr+ Zpz_sc03307.1.g00060.1.sm.mkhc 90 HSKYANLNEQLAEASLRLRQMRGEELEGLSVEELQRLEKNLEAGLHRVLQTKDQQFLEQINDLQRKSSQLAEENMQLRN 168 345566666666666889************************************************************9 PP K-box 97 kle 99 ++ Zpz_sc03307.1.g00060.1.sm.mkhc 169 QVS 171 985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 28.623 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.0E-36 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.58E-39 | 2 | 75 | No hit | No description |
PRINTS | PR00404 | 7.5E-25 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 3.66E-30 | 3 | 74 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.6E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-25 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.5E-25 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.771 | 86 | 176 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 9.1E-18 | 91 | 170 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009266 | Biological Process | response to temperature stimulus | ||||
GO:0009910 | Biological Process | negative regulation of flower development | ||||
GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0030154 | Biological Process | cell differentiation | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0048438 | Biological Process | floral whorl development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 222 aa Download sequence Send to blast |
MARERREIKR IESAAARQVT FSKRRRGLFK KAEELSVLCD ADVALIVFSS TGKLSQFASS 60 SMNEIIDKYN THSKNLGKAE QPSLDLNLEH SKYANLNEQL AEASLRLRQM RGEELEGLSV 120 EELQRLEKNL EAGLHRVLQT KDQQFLEQIN DLQRKSSQLA EENMQLRNQV SQIAPAAKQA 180 VVDTENVVAE DGQSSESVMT ALHSGSYLVF HGSNNVKAPL LV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_B | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_C | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
5f28_D | 4e-20 | 1 | 73 | 1 | 73 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. May be required for spikelet (rice flower) development. {ECO:0000269|PubMed:15682279}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00272 | DAP | Transfer from AT2G22540 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc03307.1.g00060.1.sm.mkhc |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT035420 | 0.0 | BT035420.1 Zea mays full-length cDNA clone ZM_BFb0060F04 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025810223.1 | 1e-140 | MADS-box transcription factor 22 | ||||
Swissprot | Q9XJ66 | 1e-131 | MAD22_ORYSJ; MADS-box transcription factor 22 | ||||
TrEMBL | A0A3L6RPX9 | 1e-139 | A0A3L6RPX9_PANMI; MADS-box transcription factor 22 | ||||
STRING | Sb04g033930.1 | 1e-139 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1221 | 36 | 97 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G22540.1 | 5e-65 | MIKC_MADS family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|