PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

HSF

Protein Properties

Length: 109aa MW: 12313 Da PI: 8.2578

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zpz_sc00553.1.g00040.1.sm.mk	genome	ZGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	78.9	8e-25	38	97	2	61
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 Fl+k+y++++d++++ ++sws ++nsfvv+d++ f + +Lp+yFkh+nf+SFvRQLn+Y+ Zpz_sc00553.1.g00040.1.sm.mk 38 FLTKTYDMIDDPTTDAVVSWSCTNNSFVVWDPHIFGTVLLPRYFKHNNFSSFVRQLNTYE 97 9******************888*********************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.10	1.6E-26	32	97	IPR011991	Winged helix-turn-helix DNA-binding domain
SMART	SM00415	5.0E-24	34	109	IPR000232	Heat shock factor (HSF)-type, DNA-binding
SuperFamily	SSF46785	1.36E-23	36	97	IPR011991	Winged helix-turn-helix DNA-binding domain
PRINTS	PR00056	3.6E-16	38	61	IPR000232	Heat shock factor (HSF)-type, DNA-binding
Pfam	PF00447	6.2E-21	38	97	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.6E-16	76	88	IPR000232	Heat shock factor (HSF)-type, DNA-binding
PRINTS	PR00056	3.6E-16	89	101	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
MNHRMVNPVK VESQQSLGAA NGHPLPMDGL HDGGPPPFLT KTYDMIDDPT TDAVVSWSCT 60 NNSFVVWDPH IFGTVLLPRY FKHNNFSSFV RQLNTYEKRG HCKADLVKK

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5d5u_B	1e-18	36	99	27	90	Heat shock factor protein 1
5d5v_B	1e-18	36	99	27	90	Heat shock factor protein 1
5d5v_D	1e-18	36	99	27	90	Heat shock factor protein 1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator expressed upon environmental stress that specifically binds DNA of heat shock promoter elements (HSE). Involved in heat stress response. {ECO:0000269\|PubMed:18064488}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Zpz_sc00553.1.g00040.1.sm.mk

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:18064488}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC092076	1e-46	AC092076.7 Oryza sativa chromosome 3 BAC OSJNBb0021G19 genomic sequence, complete sequence.
GenBank	AK068660	1e-46	AK068660.1 Oryza sativa Japonica Group cDNA clone:J013162K14, full insert sequence.
GenBank	AP014959	1e-46	AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBank	CT829361	1e-46	CT829361.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCPI220A14, full insert sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004981438.2	6e-56	heat stress transcription factor A-2e
Swissprot	Q6F388	5e-55	HFA2E_ORYSJ; Heat stress transcription factor A-2e
TrEMBL	K4AC79	1e-54	K4AC79_SETIT; Uncharacterized protein
STRING	Pavir.J04151.1.p	3e-57	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP308	37	231

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G22830.1	3e-38	heat shock transcription factor A6B

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]