PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zpz_sc00137.1.g00250.1.sm.mkhc | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 122aa MW: 13508.5 Da PI: 10.5544 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 89.9 | 1.3e-28 | 10 | 59 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRrngi+KKA+EL +LCdaev ++ifsstg+lyeyss Zpz_sc00137.1.g00250.1.sm.mkhc 10 RIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSS 59 8***********************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.992 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 6.78E-44 | 2 | 77 | No hit | No description |
SuperFamily | SSF55455 | 4.06E-32 | 2 | 79 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.3E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.7E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MGRGKTVIRR IDNSTSRQVT FSKRRNGIFK KAKELAILCD AEVGLMIFSS TGRLYEYSST 60 SMKSVIDRYG KAKEEQQVAA DPNSELKGGS KLETTTAQLT KESPFNFTMN QTKVLTAMAK 120 TG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 7e-21 | 1 | 77 | 1 | 77 | MEF2C |
5f28_B | 7e-21 | 1 | 77 | 1 | 77 | MEF2C |
5f28_C | 7e-21 | 1 | 77 | 1 | 77 | MEF2C |
5f28_D | 7e-21 | 1 | 77 | 1 | 77 | MEF2C |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Zpz_sc00137.1.g00250.1.sm.mkhc |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KJ728167 | 1e-101 | KJ728167.1 Zea mays clone pUT6437 MADS transcription factor (MADS39) mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002452342.2 | 7e-56 | MADS-box transcription factor 27 isoform X4 | ||||
Refseq | XP_004952891.1 | 1e-55 | MADS-box transcription factor 27 | ||||
Swissprot | Q6EP49 | 3e-54 | MAD27_ORYSJ; MADS-box transcription factor 27 | ||||
TrEMBL | A0A0D9W5U1 | 1e-61 | A0A0D9W5U1_9ORYZ; Uncharacterized protein | ||||
STRING | LPERR04G11770.2 | 2e-62 | (Leersia perrieri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37940.1 | 2e-44 | AGAMOUS-like 21 |
Publications ? help Back to Top | |||
---|---|---|---|
|