 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Zosma78g00370.1 |
Common Name | ZOSMA_78G00370 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
Family |
Dof |
Protein Properties |
Length: 101aa MW: 11286.8 Da PI: 8.3669 |
Description |
Dof family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Zosma78g00370.1 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | zf-Dof | 85.8 | 4e-27 | 26 | 83 | 3 | 61 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
+++ +cprCd+ +tk+C ny+ +qPryfC +Cr yWt+GG +rnvPvGgg rk+k+s
Zosma78g00370.1 26 QTNHNCPRCDAPDTKLCTI-NYNHTQPRYFCMSCRGYWTNGGVFRNVPVGGGYRKHKNS 83
56789************87.7***********************************987 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that negatively affects seed germination and opposes TCP14 function in the regulation of a specific set of abscisic acid-related genes (PubMed:22155632). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000269|PubMed:22155632, ECO:0000269|PubMed:30626969}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: By cytokinin in procambium. {ECO:0000269|PubMed:30626969}. |
Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - de Lucas M, et al.
Transcriptional Regulation of Arabidopsis Polycomb Repressive Complex 2 Coordinates Cell-Type Proliferation and Differentiation. Plant Cell, 2016. 28(10): p. 2616-2631 [PMID:27650334] - Ravindran P,Verma V,Stamm P,Kumar PP
A Novel RGL2-DOF6 Complex Contributes to Primary Seed Dormancy in Arabidopsis thaliana by Regulating a GATA Transcription Factor. Mol Plant, 2017. 10(10): p. 1307-1320 [PMID:28917589] - Miyashima S, et al.
Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]
|