PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma57g00650.1 | ||||||||
Common Name | ZOSMA_57G00650 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 110aa MW: 12110.8 Da PI: 8.2122 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 144.9 | 1.8e-45 | 24 | 108 | 3 | 87 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvyl 87 +d+flPianvsrimk++lP nakisk+aket+qecvsef+sf+t+eas+kc+ ekrktingddllw++ l f+ y plkvyl Zosma57g00650.1 24 SNDQFLPIANVSRIMKRALPVNAKISKEAKETIQECVSEFVSFITGEASEKCHSEKRKTINGDDLLWSMNRLDFDPYTIPLKVYL 108 589*********************************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.3E-42 | 19 | 108 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 8.96E-33 | 26 | 108 | IPR009072 | Histone-fold |
Pfam | PF00808 | 7.9E-27 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.6E-14 | 56 | 74 | No hit | No description |
PRINTS | PR00615 | 2.6E-14 | 75 | 93 | No hit | No description |
PRINTS | PR00615 | 2.6E-14 | 94 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 110 aa Download sequence Send to blast |
MGLATNNPMV GSSSNSNSKR DAASNDQFLP IANVSRIMKR ALPVNAKISK EAKETIQECV 60 SEFVSFITGE ASEKCHSEKR KTINGDDLLW SMNRLDFDPY TIPLKVYLV* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 2e-38 | 25 | 108 | 5 | 88 | NF-YB |
4awl_B | 2e-38 | 25 | 108 | 6 | 89 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 2e-38 | 25 | 108 | 6 | 89 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004139999.1 | 1e-47 | PREDICTED: nuclear transcription factor Y subunit B-3 | ||||
Refseq | XP_022140566.1 | 5e-48 | nuclear transcription factor Y subunit B-3-like, partial | ||||
Refseq | XP_023513391.1 | 1e-47 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 4e-46 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
Swissprot | Q69J40 | 9e-46 | NFYBA_ORYSJ; Nuclear transcription factor Y subunit B-10 | ||||
TrEMBL | A0A0K9NVS1 | 2e-75 | A0A0K9NVS1_ZOSMR; Nuclear transcription factor Y subunit B-3 | ||||
STRING | XP_004139999.1 | 5e-47 | (Cucumis sativus) | ||||
STRING | XP_004154508.1 | 5e-47 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP201 | 38 | 331 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-48 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma57g00650.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|