![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma44g00750.1 | ||||||||
Common Name | ZOSMA_44G00750 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 150aa MW: 16815.2 Da PI: 9.2221 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 43 | 1e-13 | 28 | 82 | 5 | 59 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevakl 59 ++ +rkq+NR +ArrsR RK+++++eL + ++L++eN++L +++ ++ +++++ Zosma44g00750.1 28 RNLKRKQSNRDSARRSRMRKQQQLDELLKQTAQLKNENEKLSMQINVITAHYSEV 82 5789*****************************************9999888766 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 1.5E-12 | 24 | 88 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 10.68 | 26 | 89 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 4.1E-11 | 27 | 77 | No hit | No description |
Pfam | PF00170 | 9.3E-11 | 28 | 81 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 5.94E-11 | 28 | 82 | No hit | No description |
CDD | cd14702 | 4.64E-16 | 30 | 80 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 31 | 46 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006971 | Biological Process | hypotonic response | ||||
GO:0009267 | Biological Process | cellular response to starvation | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:2000693 | Biological Process | positive regulation of seed maturation | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 150 aa Download sequence Send to blast |
MASSQVQNNS SSGSSSGNSD PQGIITERNL KRKQSNRDSA RRSRMRKQQQ LDELLKQTAQ 60 LKNENEKLSM QINVITAHYS EVVSRNLVLE TQLVELTERL KSVNSVLRFV EEFSGMEIDI 120 PELPDPLLKP WKLPCPIQAI LASPSMLQP* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 40 | 47 | RRSRMRKQ |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00419 | DAP | Transfer from AT3G62420 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020114228.1 | 3e-54 | bZIP transcription factor 53-like | ||||
TrEMBL | A0A0K9P0V1 | 1e-102 | A0A0K9P0V1_ZOSMR; Basic-leucine zipper (BZIP) transcription factor family | ||||
STRING | XP_008813386.1 | 2e-52 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1886 | 35 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 4e-20 | basic region/leucine zipper motif 53 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma44g00750.1 |