PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma41g00660.1 | ||||||||
Common Name | ZOSMA_41G00660 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 101aa MW: 12114.9 Da PI: 10.4759 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 26.6 | 1.4e-08 | 33 | 71 | 4 | 44 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 +T eE++l+++ +++ G + W +Ia +++ gR ++++ +w Zosma41g00660.1 33 MTDEEEDLIYRMHRLVGDR-WGLIAGRIP-GRKAEEIERFW 71 79***************99.*********.********999 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 4.7E-5 | 29 | 77 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.25E-5 | 32 | 71 | No hit | No description |
Pfam | PF00249 | 1.0E-7 | 33 | 72 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.3E-10 | 33 | 72 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.017 | 34 | 71 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 2.11E-7 | 34 | 72 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010091 | Biological Process | trichome branching | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 101 aa Download sequence Send to blast |
MDNRRMRKMV AAETSKNNES EEVSSIEWEY INMTDEEEDL IYRMHRLVGD RWGLIAGRIP 60 GRKAEEIERF WIMKHGDMFA EKRRQKSLKK NKNKNKNKKK * |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Involved in epidermal cell fate specification. Negative regulator of trichome development, including endoreplication, by lateral inhibition involving intercellular interactions. Promotes the formation of hair developing cells (trichoblasts) in H position in root epidermis, probably by inhibiting non-hair cell (atrichoblasts) formation. {ECO:0000269|PubMed:10368181, ECO:0000269|PubMed:12356720}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negative autoregulation. Repressed by CPC. {ECO:0000269|PubMed:12356720}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018827880.1 | 7e-38 | PREDICTED: transcription factor CPC | ||||
Swissprot | Q8GV05 | 3e-34 | TRY_ARATH; Transcription factor TRY | ||||
TrEMBL | A0A0K9P4S6 | 1e-65 | A0A0K9P4S6_ZOSMR; Myb family transcription factor | ||||
STRING | XP_006491245.1 | 7e-37 | (Citrus sinensis) | ||||
STRING | XP_006444875.1 | 7e-37 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5275 | 31 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53200.1 | 2e-35 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma41g00660.1 |