![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma3g01640.1 | ||||||||
Common Name | ZOSMA_3G01640 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 66aa MW: 7490.48 Da PI: 5.5618 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 44.1 | 5.7e-14 | 1 | 56 | 45 | 100 |
DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100 +l++lp +ere+a++s+ eA r++ PvyG vg+i++lq++++++++el+++++e Zosma3g01640.1 1 MLQKLPYNEREEAANSISHEAYLRVQHPVYGIVGTITNLQEEIHRKQQELVRIEAE 56 799***********************************************998876 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03195 | 1.2E-11 | 1 | 53 | IPR004883 | Lateral organ boundaries, LOB |
PROSITE profile | PS50891 | 10.411 | 1 | 57 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 66 aa Download sequence Send to blast |
MLQKLPYNER EEAANSISHE AYLRVQHPVY GIVGTITNLQ EEIHRKQQEL VRIEAEIAIY 60 TAGNL* |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010927283.2 | 3e-16 | LOW QUALITY PROTEIN: LOB domain-containing protein 24-like | ||||
TrEMBL | A0A0K9P676 | 7e-39 | A0A0K9P676_ZOSMR; Uncharacterized protein |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP27534 | 4 | 4 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 1e-14 | LOB domain-containing protein 24 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma3g01640.1 |