![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma24g00620.1 | ||||||||
Common Name | ZOSMA_24G00620 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 172aa MW: 18438.5 Da PI: 8.0639 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 147.8 | 2.2e-46 | 20 | 112 | 5 | 97 |
NF-YB 5 drflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 d++l ian+ rimkk++P+naki k+aket+qec+sefisfvtsea+dkc++e+rkt+ng+d++wa++tlGf+ +v+p+k yl+kyr+ e+++ Zosma24g00620.1 20 DQLLSIANMRRIMKKIFPSNAKILKEAKETMQECASEFISFVTSEAADKCNKERRKTVNGNDICWAFGTLGFDSFVQPMKRYLNKYRDYESKR 112 899*************************************************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 2.9E-43 | 18 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.84E-33 | 20 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 4.1E-24 | 23 | 85 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 5.7E-17 | 50 | 68 | No hit | No description |
PRINTS | PR00615 | 5.7E-17 | 69 | 87 | No hit | No description |
PRINTS | PR00615 | 5.7E-17 | 88 | 106 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 172 aa Download sequence Send to blast |
MADGGSSSTT AETSGGGGGD QLLSIANMRR IMKKIFPSNA KILKEAKETM QECASEFISF 60 VTSEAADKCN KERRKTVNGN DICWAFGTLG FDSFVQPMKR YLNKYRDYES KRAATAAATA 120 AAEATLFRHA GSGDGDNHNQ DGNSDRHFKM DLAGPSSETT TTTLSFNVLG K* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-34 | 20 | 107 | 6 | 93 | NF-YB |
4g91_B | 1e-34 | 20 | 107 | 5 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 1e-34 | 20 | 107 | 5 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_027071612.1 | 1e-49 | nuclear transcription factor Y subunit B-5-like | ||||
Refseq | XP_027174014.1 | 1e-49 | nuclear transcription factor Y subunit B-5-like | ||||
Swissprot | Q75IZ7 | 2e-42 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0K9PGF0 | 1e-124 | A0A0K9PGF0_ZOSMR; Nuclear transcription factor Y subunit B-5 | ||||
STRING | GSMUA_Achr11P05710_001 | 2e-48 | (Musa acuminata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 2e-43 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma24g00620.1 |
Publications ? help Back to Top | |||
---|---|---|---|
|