![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zosma221g00110.1 | ||||||||
Common Name | ZOSMA_221G00110 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Zosteraceae; Zostera
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 122aa MW: 14469.4 Da PI: 11.1462 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 44.9 | 2.4e-14 | 49 | 101 | 4 | 56 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 +++ r++++NR +ArrsR RK+++++eL + v +L + N++L el++ + + Zosma221g00110.1 49 DRKLRKRISNRDSARRSRMRKQKYVDELWQQVINLRGWNQRLVAELNRVTALL 101 7899*******************************************988765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.3E-12 | 46 | 110 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 9.956 | 48 | 111 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.4E-11 | 48 | 103 | No hit | No description |
Pfam | PF00170 | 7.0E-12 | 49 | 108 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 7.5E-11 | 50 | 102 | No hit | No description |
CDD | cd14702 | 1.61E-11 | 51 | 98 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 53 | 68 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 122 aa Download sequence Send to blast |
MTTTRNDQAP SSFTFAGIYS DHQTSVFPPR AEMFENDEAR RIQMQILKDR KLRKRISNRD 60 SARRSRMRKQ KYVDELWQQV INLRGWNQRL VAELNRVTAL LDQILRENSN LRDEISHLHQ 120 S* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 48 | 54 | DRKLRKR |
2 | 62 | 69 | RRSRMRKQ |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00262 | DAP | Transfer from AT2G04038 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008804405.1 | 2e-24 | basic leucine zipper 43-like | ||||
TrEMBL | A0A0K9PLL2 | 2e-83 | A0A0K9PLL2_ZOSMR; Uncharacterized protein | ||||
STRING | XP_008804405.1 | 8e-24 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1186 | 35 | 126 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G04038.1 | 3e-22 | basic leucine-zipper 48 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Zosma221g00110.1 |