PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc08932.1.g00030.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 100aa MW: 11041.6 Da PI: 10.1394 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 122.5 | 6.2e-38 | 3 | 56 | 117 | 170 |
YABBY 117 rPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170 r PekrqrvPsaynrfik+eiqrika+nPdi+hreafsaaaknWahfP+ihfgl Zmw_sc08932.1.g00030.1.am.mk 3 RAPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGL 56 89**************************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.8E-36 | 2 | 56 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 6.68E-8 | 3 | 50 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 6.0E-5 | 5 | 48 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0007275 | Biological Process | multicellular organism development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 100 aa Download sequence Send to blast |
MYRAPEKRQR VPSAYNRFIK DEIQRIKAGN PDITHREAFS AAAKNWAHFP HIHFGLMPDQ 60 GLKKTFKTQD GAEDMLLKDG LYAAAAAAAA AAVNTGVTPF |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Seems to be associated with phloem cell differentiation. {ECO:0000269|PubMed:17676337}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002452852.1 | 1e-56 | protein YABBY 4 | ||||
Swissprot | A2X7Q3 | 2e-55 | YAB4_ORYSI; Protein YABBY 4 | ||||
Swissprot | Q6H668 | 2e-55 | YAB4_ORYSJ; Protein YABBY 4 | ||||
TrEMBL | A0A3L6QIB7 | 1e-55 | A0A3L6QIB7_PANMI; Uncharacterized protein | ||||
STRING | Sb04g033590.1 | 4e-56 | (Sorghum bicolor) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1445 | 38 | 121 |
Publications ? help Back to Top | |||
---|---|---|---|
|