![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc07997.1.g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 170aa MW: 19847.6 Da PI: 8.4382 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 178.8 | 1.4e-55 | 8 | 137 | 1 | 129 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk...kvkaeekewyfFskrdkkyatgkrknrat 78 +ppGfrFhPtdeelv +yL+kkv+++k++l +vi+++d+y++ePwdL++ + e+++wyfFs +d+ky+tg+r+nrat Zmw_sc07997.1.g00010.1.sm.mk 8 VPPGFRFHPTDEELVGYYLRKKVASQKIDL-DVIRDIDLYRIEPWDLQEhcgIGYDEQNDWYFFSYKDRKYPTGTRTNRAT 87 69****************************.9***************953432233677********************** PP NAM 79 ksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129 +g+Wkatg+dk+v++ kg+l+g++ktLvfykgrap+g+ktdW+mheyrle Zmw_sc07997.1.g00010.1.sm.mk 88 MAGFWKATGRDKAVHD-KGRLIGMRKTLVFYKGRAPNGQKTDWIMHEYRLE 137 ****************.999*****************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-57 | 6 | 142 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 54.813 | 8 | 163 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.9E-29 | 9 | 136 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MDSMKSCVPP GFRFHPTDEE LVGYYLRKKV ASQKIDLDVI RDIDLYRIEP WDLQEHCGIG 60 YDEQNDWYFF SYKDRKYPTG TRTNRATMAG FWKATGRDKA VHDKGRLIGM RKTLVFYKGR 120 APNGQKTDWI MHEYRLETDE NAPPQARSLP NLSDLLPCSA MQFNIIGFII |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3ulx_A | 8e-51 | 8 | 136 | 15 | 140 | Stress-induced transcription factor NAC1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the secondary wall NAC binding element (SNBE), 5'-(T/A)NN(C/T)(T/C/G)TNNNNNNNA(A/C)GN(A/C/T)(A/T)-3', in the promoter of target genes (By similarity). Involved in xylem formation by promoting the expression of secondary wall-associated transcription factors and of genes involved in secondary wall biosynthesis and programmed cell death, genes driven by the secondary wall NAC binding element (SNBE). Triggers thickening of secondary walls (PubMed:25148240). {ECO:0000250|UniProtKB:Q9LVA1, ECO:0000269|PubMed:25148240}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by chitin (e.g. chitooctaose) (PubMed:17722694). Accumulates in plants exposed to callus induction medium (CIM) (PubMed:17581762). {ECO:0000269|PubMed:17581762, ECO:0000269|PubMed:17722694}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002465947.1 | 1e-104 | NAC domain-containing protein 37 | ||||
Swissprot | Q9SL41 | 5e-95 | NAC37_ARATH; NAC domain-containing protein 37 | ||||
TrEMBL | A0A0K1TPG3 | 1e-102 | A0A0K1TPG3_PANVG; Secondary wall NAC master switch | ||||
TrEMBL | A0A3L6S5S2 | 1e-103 | A0A3L6S5S2_PANMI; Uncharacterized protein | ||||
TrEMBL | M8B384 | 1e-102 | M8B384_AEGTA; NAC domain-containing protein 7 | ||||
STRING | Pavir.J32898.1.p | 1e-106 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP3625 | 37 | 68 |
Publications ? help Back to Top | |||
---|---|---|---|
|