PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc06112.1.g00010.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 81aa MW: 9147.68 Da PI: 10.7514 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 100.7 | 5.6e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtfskRrng+lKKA+E+SvLCdaeva i+fs++gkl+ey++ Zmw_sc06112.1.g00010.1.am.mk 9 KRIENKINRQVTFSKRRNGLLKKAHEISVLCDAEVAAIVFSPRGKLHEYAT 59 79***********************************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 3.9E-42 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 32.59 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.46E-31 | 2 | 66 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 2.19E-39 | 2 | 64 | No hit | No description |
PRINTS | PR00404 | 4.9E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.0E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 4.9E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 81 aa Download sequence Send to blast |
MGRGKVQLKR IENKINRQVT FSKRRNGLLK KAHEISVLCD AEVAAIVFSP RGKLHEYATD 60 SRKKASAGFC PFCPRMDYAH A |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 6e-20 | 1 | 72 | 1 | 72 | MEF2C |
5f28_B | 6e-20 | 1 | 72 | 1 | 72 | MEF2C |
5f28_C | 6e-20 | 1 | 72 | 1 | 72 | MEF2C |
5f28_D | 6e-20 | 1 | 72 | 1 | 72 | MEF2C |
6byy_A | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_B | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_C | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6byy_D | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_A | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_B | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_C | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
6bz1_D | 7e-20 | 1 | 72 | 1 | 72 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015645262.1 | 6e-36 | MADS-box transcription factor 15 isoform X4 | ||||
Swissprot | Q6Q9I2 | 3e-34 | MAD15_ORYSJ; MADS-box transcription factor 15 | ||||
TrEMBL | A0A0P0X1J5 | 2e-36 | A0A0P0X1J5_ORYSJ; Os07g0108900 protein | ||||
STRING | Pavir.Ba03990.1.p | 7e-36 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP129 | 38 | 398 |