PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04415.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9022.66 Da    PI: 10.527
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04415.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF102.12e-32959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+iifs++gklyey++
  Zmw_sc04415.1.g00010.1.am.mk  9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIIFSTKGKLYEYAT 59
                                  79***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.207161IPR002100Transcription factor, MADS-box
SMARTSM004325.2E-41160IPR002100Transcription factor, MADS-box
CDDcd002654.57E-38262No hitNo description
SuperFamilySSF554557.98E-31268IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.3E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-333859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MGRGKVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIIFST KGKLYEYATD  60
SCGGYCARLG RSVVSVLLPH I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5f28_A2e-21159159MEF2C
5f28_B2e-21159159MEF2C
5f28_C2e-21159159MEF2C
5f28_D2e-21159159MEF2C
6byy_A2e-21159159MEF2 CHIMERA
6byy_B2e-21159159MEF2 CHIMERA
6byy_C2e-21159159MEF2 CHIMERA
6byy_D2e-21159159MEF2 CHIMERA
6bz1_A2e-21159159MEF2 CHIMERA
6bz1_B2e-21159159MEF2 CHIMERA
6bz1_C2e-21159159MEF2 CHIMERA
6bz1_D2e-21159159MEF2 CHIMERA
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor involved in flower development. {ECO:0000250|UniProtKB:Q0HA25}.
UniProtProbable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001288319.16e-37MADS-box transcription factor 14-like
RefseqXP_002463864.17e-37MADS-box transcription factor 14 isoform X2
RefseqXP_021320421.17e-37MADS-box transcription factor 14 isoform X2
SwissprotQ388761e-35AGL8_ARATH; Agamous-like MADS-box protein AGL8
SwissprotQ412741e-35AGL8_SINAL; Agamous-like MADS-box protein AGL8 homolog
SwissprotQ6E6S78e-36AP1_VITVI; Agamous-like MADS-box protein AP1
TrEMBLA0A0A9QQM87e-36A0A0A9QQM8_ARUDO; Uncharacterized protein
TrEMBLA0A317YFV52e-36A0A317YFV5_MAIZE; Uncharacterized protein
STRINGcassava4.1_028214m2e-36(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Publications ? help Back to Top
  1. Jaillon O, et al.
    The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla.
    Nature, 2007. 449(7161): p. 463-7
    [PMID:17721507]
  2. Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ
    Genome-wide analysis of MIKCC-type MADS box genes in grapevine.
    Plant Physiol., 2009. 149(1): p. 354-69
    [PMID:18997115]
  3. Yu Y, et al.
    MlWRKY12, a novel Miscanthus transcription factor, participates in pith secondary cell wall formation and promotes flowering.
    Plant Sci., 2013. 212: p. 1-9
    [PMID:24094048]
  4. Pabón-Mora N,Wong GK,Ambrose BA
    Evolution of fruit development genes in flowering plants.
    Front Plant Sci, 2014. 5: p. 300
    [PMID:25018763]
  5. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  6. Wang C,Dehesh K
    From retrograde signaling to flowering time.
    Plant Signal Behav, 2015. 10(6): p. e1022012
    [PMID:26098376]
  7. Borghi M,Xie DY
    Tissue-specific production of limonene in Camelina sativa with the Arabidopsis promoters of genes BANYULS and FRUITFULL.
    Planta, 2016. 243(2): p. 549-61
    [PMID:26530959]
  8. Yu Y, et al.
    WRKY71 accelerates flowering via the direct activation of FLOWERING LOCUS T and LEAFY in Arabidopsis thaliana.
    Plant J., 2016. 85(1): p. 96-106
    [PMID:26643131]
  9. McCarthy EW,Mohamed A,Litt A
    Functional Divergence of APETALA1 and FRUITFULL is due to Changes in both Regulation and Coding Sequence.
    Front Plant Sci, 2015. 6: p. 1076
    [PMID:26697035]
  10. Grimplet J,Martínez-Zapater JM,Carmona MJ
    Structural and functional annotation of the MADS-box transcription factor family in grapevine.
    BMC Genomics, 2016. 17: p. 80
    [PMID:26818751]
  11. Davin N, et al.
    Functional network analysis of genes differentially expressed during xylogenesis in soc1ful woody Arabidopsis plants.
    Plant J., 2016. 86(5): p. 376-90
    [PMID:26952251]
  12. Hyun Y, et al.
    Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem.
    Dev. Cell, 2016. 37(3): p. 254-66
    [PMID:27134142]
  13. José Ripoll J, et al.
    microRNA regulation of fruit growth.
    Nat Plants, 2015. 1(4): p. 15036
    [PMID:27247036]
  14. Li W,Wang H,Yu D
    Arabidopsis WRKY Transcription Factors WRKY12 and WRKY13 Oppositely Regulate Flowering under Short-Day Conditions.
    Mol Plant, 2016. 9(11): p. 1492-1503
    [PMID:27592586]
  15. Eldridge T, et al.
    Fruit shape diversity in the Brassicaceae is generated by varying patterns of anisotropy.
    Development, 2016. 143(18): p. 3394-406
    [PMID:27624834]
  16. Bemer M, et al.
    FRUITFULL controls SAUR10 expression and regulates Arabidopsis growth and architecture.
    J. Exp. Bot., 2017. 68(13): p. 3391-3403
    [PMID:28586421]
  17. Sehra B,Franks RG
    Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development.
    Front Plant Sci, 2017. 8: p. 1712
    [PMID:29085379]
  18. Balanzà V, et al.
    Genetic control of meristem arrest and life span in Arabidopsis by a FRUITFULL-APETALA2 pathway.
    Nat Commun, 2018. 9(1): p. 565
    [PMID:29422669]
  19. Menzel G,Apel K,Melzer S
    Identification of two MADS box genes that are expressed in the apical meristem of the long-day plant Sinapis alba in transition to flowering.
    Plant J., 1996. 9(3): p. 399-408
    [PMID:8919916]