|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Zmw_sc04334.1.g00070.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
Family |
M-type_MADS |
Protein Properties |
Length: 111aa MW: 11707.4 Da PI: 10.2606 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Zmw_sc04334.1.g00070.1 | genome | ZGD | - |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 97.8 | 4.5e-31 | 59 | 109 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRr g+lKKA+ELSvLCdae+a+++fss+g+lyeys+
Zmw_sc04334.1.g00070.1.sm.mk 59 KRIENTTNRQVTFCKRRSGLLKKAYELSVLCDAEIALVVFSSRGRLYEYSN 109
79***********************************************95 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
1tqe_R | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
1tqe_S | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
6c9l_A | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
6c9l_B | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
6c9l_C | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
6c9l_D | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
6c9l_E | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
6c9l_F | 5e-20 | 54 | 108 | 4 | 58 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269|PubMed:16326928}. |
Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Cheng CH, et al.
A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] - Li H, et al.
Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] - Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T
Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] - Yun D, et al.
OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] - Yan D, et al.
Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] - Zheng M, et al.
DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] - Chen R, et al.
A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] - Hu Y, et al.
Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]
|