PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc03185.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family M-type_MADS
Protein Properties Length: 60aa    MW: 6939.09 Da    PI: 10.2914
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc03185.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF97.36.4e-31959151
                                  S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                        SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                                  krien++ rqvtf+kRrng+lKKA+ELS+LCdae+a+iifs +g+lyeys+
  Zmw_sc03185.1.g00010.1.sm.mk  9 KRIENTTSRQVTFCKRRNGLLKKAYELSILCDAEIALIIFSGRGRLYEYSN 59
                                  79***********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006633.011160IPR002100Transcription factor, MADS-box
SMARTSM004321.6E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.4E-29259IPR002100Transcription factor, MADS-box
CDDcd002651.36E-37260No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-32323IPR002100Transcription factor, MADS-box
PfamPF003194.9E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-322338IPR002100Transcription factor, MADS-box
PRINTSPR004041.1E-323859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 60 aa     Download sequence    Send to blast
MGRGKIEIKR IENTTSRQVT FCKRRNGLLK KAYELSILCD AEIALIIFSG RGRLYEYSNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20160160Myocyte-specific enhancer factor 2B
1tqe_Q2e-20160160Myocyte-specific enhancer factor 2B
1tqe_R2e-20160160Myocyte-specific enhancer factor 2B
1tqe_S2e-20160160Myocyte-specific enhancer factor 2B
6c9l_A2e-20160160Myocyte-specific enhancer factor 2B
6c9l_B2e-20160160Myocyte-specific enhancer factor 2B
6c9l_C2e-20160160Myocyte-specific enhancer factor 2B
6c9l_D2e-20160160Myocyte-specific enhancer factor 2B
6c9l_E2e-20160160Myocyte-specific enhancer factor 2B
6c9l_F2e-20160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor.
UniProtProbable transcription factor involved in the development of floral organs. Acts as C-class protein in association with MADS58. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3) and floral meristem determinacy (whorl 4), but not in the regulation of carpel morphogenesis. Plays a more predominant role in controlling lodicule development and in specifying stamen identity than MADS58. {ECO:0000269|PubMed:11828031, ECO:0000269|PubMed:16326928, ECO:0000269|PubMed:9869408}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010930410.12e-35MADS-box transcription factor 21 isoform X1
RefseqXP_010930411.12e-35floral homeotic protein AGAMOUS isoform X2
RefseqXP_010930412.12e-35floral homeotic protein AGAMOUS isoform X2
RefseqXP_019708448.12e-35MADS-box transcription factor 21 isoform X1
RefseqXP_029122449.12e-35MADS-box transcription factor 21 isoform X1
RefseqXP_029122451.12e-35floral homeotic protein AGAMOUS isoform X2
SwissprotQ2QW537e-35MAD13_ORYSJ; MADS-box transcription factor 13
SwissprotQ407044e-35MADS3_ORYSJ; MADS-box transcription factor 3
TrEMBLA0A0K9NM355e-34A0A0K9NM35_ZOSMR; AGAMOUS MADS box factor transcription factor
TrEMBLA0A3S6K7M66e-34A0A3S6K7M6_DENLA; MADS21
TrEMBLA0A452Y6Q54e-34A0A452Y6Q5_AEGTS; Uncharacterized protein
TrEMBLA0A452Y6R75e-34A0A452Y6R7_AEGTS; Uncharacterized protein
STRINGTraes_1BS_1202C8C0D.24e-34(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Publications ? help Back to Top
  1. Kyozuka J,Shimamoto K
    Ectopic expression of OsMADS3, a rice ortholog of AGAMOUS, caused a homeotic transformation of lodicules to stamens in transgenic rice plants.
    Plant Cell Physiol., 2002. 43(1): p. 130-5
    [PMID:11828031]
  2. Gindullis F,Rose A,Patel S,Meier I
    Four signature motifs define the first class of structurally related large coiled-coil proteins in plants.
    BMC Genomics, 2002. 3: p. 9
    [PMID:11972898]
  3. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  4. Yamaki S,Satoh H,Nagato Y
    Gypsy embryo specifies ovule curvature by regulating ovule/integument development in rice.
    Planta, 2005. 222(3): p. 408-17
    [PMID:16001259]
  5. Dreni L, et al.
    The D-lineage MADS-box gene OsMADS13 controls ovule identity in rice.
    Plant J., 2007. 52(4): p. 690-9
    [PMID:17877710]
  6. Yamaki S,Nagato Y,Kurata N,Nonomura K
    Ovule is a lateral organ finally differentiated from the terminating floral meristem in rice.
    Dev. Biol., 2011. 351(1): p. 208-16
    [PMID:21146515]
  7. Li H,Liang W,Yin C,Zhu L,Zhang D
    Genetic interaction of OsMADS3, DROOPING LEAF, and OsMADS13 in specifying rice floral organ identities and meristem determinacy.
    Plant Physiol., 2011. 156(1): p. 263-74
    [PMID:21444646]
  8. Li H, et al.
    Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate.
    Plant Cell, 2011. 23(7): p. 2536-52
    [PMID:21784949]