![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Zmw_sc02904.1.g00120.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 140aa MW: 15135.1 Da PI: 8.4138 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 79.4 | 5.3e-25 | 61 | 112 | 2 | 53 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 CqvegC dl+ akeyhr+h+vCe+h+k+p v+v+g+e+rfCqqCsr+ l Zmw_sc02904.1.g00120.1.am.mk 61 CQVEGCGLDLTGAKEYHRKHRVCEAHTKCPRVVVAGHERRFCQQCSRWVWLP 112 ***********************************************97765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 1.7E-24 | 54 | 108 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.136 | 58 | 135 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 6.8E-24 | 59 | 113 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 6.7E-19 | 61 | 108 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
MEWTVPKPAA SPSSQPLLWD WGDSATPASG SSGEAPARRG GREREGKRAK GEDGGAGEVK 60 CQVEGCGLDL TGAKEYHRKH RVCEAHTKCP RVVVAGHERR FCQQCSRWVW LPDLLLSISR 120 MSSAVDLVDC RAASSRASCA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 6e-15 | 59 | 114 | 4 | 59 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004951747.1 | 4e-58 | squamosa promoter-binding-like protein 4 | ||||
Swissprot | Q6H509 | 1e-32 | SPL4_ORYSJ; Squamosa promoter-binding-like protein 4 | ||||
TrEMBL | A0A1E5WDC1 | 2e-59 | A0A1E5WDC1_9POAL; Squamosa promoter-binding-like protein 11 | ||||
STRING | Pavir.J20730.1.p | 2e-58 | (Panicum virgatum) | ||||
STRING | Si017749m | 2e-57 | (Setaria italica) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6271 | 29 | 52 |
Publications ? help Back to Top | |||
---|---|---|---|
|