PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Function |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

Zjn_sc02086.1.g00010.1.sm.mk

Organism

Zoysia japonica

Taxonomic ID

309978

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

TALE

Protein Properties

Length: 164aa MW: 18667 Da PI: 9.5264

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zjn_sc02086.1.g00010.1.sm.mk	genome	ZGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	30.9	4.7e-10	94	127	22	55
SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 +yp++e++ +LA+ +gL+ +q+ +WF N+R ++ Zjn_sc02086.1.g00010.1.sm.mk 94 WPYPTEEDKVRLAAMTGLDPKQINNWFINQRKRH 127 59*****************************985 PP
2	ELK	34.3	5.2e-12	47	68	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsg+L+ L++EF+ Zjn_sc02086.1.g00010.1.sm.mk 47 ELKEMLLKKYSGCLSRLRSEFL 68 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	6.1E-9	47	68	IPR005539	ELK domain
SMART	SM01188	3.6E-6	47	68	IPR005539	ELK domain
PROSITE profile	PS51213	10.423	47	67	IPR005539	ELK domain
PROSITE profile	PS50071	12.438	67	130	IPR001356	Homeobox domain
SMART	SM00389	5.3E-14	69	134	IPR001356	Homeobox domain
SuperFamily	SSF46689	4.19E-20	69	139	IPR009057	Homeodomain-like
CDD	cd00086	1.29E-13	70	131	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-27	73	132	IPR009057	Homeodomain-like
Pfam	PF05920	1.9E-17	87	126	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	105	128	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 164 aa Download sequence Send to blast
LKKGLWPPSY GLNYITAGSS EDEPYSGDTD ATELGQQEHS SRLADRELKE MLLKKYSGCL 60 SRLRSEFLKK RTKGKLPKDA RSALMDWWNT HYRWPYPTEE DKVRLAAMTG LDPKQINNWF 120 INQRKRHWKP SEDMRFALME GVTGGGGSSS GTTTLYFDTG TIGP

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693}.
UniProt	Probable transcription factor that may be involved in shoot formation during embryogenesis. {ECO:0000269\|PubMed:10080693, ECO:0000269\|PubMed:10488233}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AF457118	1e-133	AF457118.1 Zea mays knotted1-like homeodomain protein liguleless4a (lg4a) mRNA, complete cds.
GenBank	BT085252	1e-133	BT085252.1 Zea mays full-length cDNA clone ZM_BFb0343E20 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020397912.1	1e-83	liguleless 4 isoform X1
Swissprot	A2Y007	1e-83	KNOSA_ORYSI; Homeobox protein knotted-1-like 10
Swissprot	Q7GDL5	1e-83	KNOSA_ORYSJ; Homeobox protein knotted-1-like 10
TrEMBL	A0A0E0KY08	2e-83	A0A0E0KY08_ORYPU; Uncharacterized protein
STRING	OPUNC05G01700.4	3e-84	(Oryza punctata)
STRING	GRMZM2G094241_P01	8e-83	(Zea mays)
STRING	LPERR05G01890.1	9e-83	(Leersia perrieri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1698	38	92

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G23380.2	7e-44	KNOTTED1-like homeobox gene 6

Publications ? help Back to Top
Ito Y,Eiguchi M,Kurata N KNOX homeobox genes are sufficient in maintaining cultured cells in an undifferentiated state in rice. Genesis, 2001. 30(4): p. 231-8 [PMID:11536429] Postma-Haarsma AD, et al. Developmental regulation and downstream effects of the knox class homeobox genes Oskn2 and Oskn3 from rice. Plant Mol. Biol., 2002. 48(4): p. 423-41 [PMID:11908517] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Different subcellular localization and trafficking properties of KNOX class 1 homeodomain proteins from rice. Plant Mol. Biol., 2004. 55(6): p. 781-96 [PMID:15604716] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Chu H, et al. A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Coudert Y, et al. Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012] Xu Y, et al. OsARID3, an AT-rich Interaction Domain-containing protein, is required for shoot meristem development in rice. Plant J., 2015. 83(5): p. 806-17 [PMID:26121094] Kir G, et al. RNA Interference Knockdown of BRASSINOSTEROID INSENSITIVE1 in Maize Reveals Novel Functions for Brassinosteroid Signaling in Controlling Plant Architecture. Plant Physiol., 2015. 169(1): p. 826-39 [PMID:26162429]