PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zjn_sc00197.1.g00010.1.sm.mk

Organism

Zoysia japonica

Taxonomic ID

309978

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

NAC

Protein Properties

Length: 265aa MW: 30411.7 Da PI: 5.9097

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zjn_sc00197.1.g00010.1.sm.mk	genome	ZGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	158.2	3.4e-49	20	150	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 lp Gf FhP+dee++++yLk+k+ ++ +++ ++i+++di+++ePw+Lp+k+k +ekewyf++++d+ky++g r nrat++g Zjn_sc00197.1.g00010.1.sm.mk 20 LPLGFGFHPSDEEIITFYLKPKMLDSYFTA-DAIADADINNSEPWELPMKAKMGEKEWYFYCQKDHKYQKGMRINRATNDG 99 699**********************999.99***********99999************************ PP NAM 82 yWkatgkdkevlsk...kgelvglkktLvfykgrapkgektdWvmheyrle 129 +Wkatgkdke+++ ++vg+kktLvfy gr+p g kt+W+mheyrle Zjn_sc00197.1.g00010.1.sm.mk 100 FWKATGKDKEIYQVssmMPAVVGMKKTLVFYIGRSPWGDKTEWIMHEYRLE 150 ********984444455**************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.62E-56	17	176	IPR003441	NAC domain
PROSITE profile	PS51005	53.139	20	176	IPR003441	NAC domain
Pfam	PF02365	9.8E-25	21	149	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 265 aa Download sequence Send to blast
MENHKYEGIR STVDDAGLNL PLGFGFHPSD EEIITFYLKP KMLDSYFTAD AIADADINNS 60 EPWELPMKAK MGEKEWYFYC QKDHKYQKGM RINRATNDGF WKATGKDKEI YQVSSMMPAV 120 VGMKKTLVFY IGRSPWGDKT EWIMHEYRLE GSGKFCCPSS SSNISKEWVV CRVFHKSLRN 180 MDMHMLPYEE AIANTNTNQS SMSFPTSMQF LLEPEDFSIE LSALYPHRDM TMPFYSTIDA 240 SSSVAPSMSA MKNMGIVDID GIKKY

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	3e-43	8	177	5	166	NO APICAL MERISTEM PROTEIN
1ut4_B	3e-43	8	177	5	166	NO APICAL MERISTEM PROTEIN
1ut7_A	3e-43	8	177	5	166	NO APICAL MERISTEM PROTEIN
1ut7_B	3e-43	8	177	5	166	NO APICAL MERISTEM PROTEIN
3swm_A	4e-43	8	177	8	169	NAC domain-containing protein 19
3swm_B	4e-43	8	177	8	169	NAC domain-containing protein 19
3swm_C	4e-43	8	177	8	169	NAC domain-containing protein 19
3swm_D	4e-43	8	177	8	169	NAC domain-containing protein 19
3swp_A	4e-43	8	177	8	169	NAC domain-containing protein 19
3swp_B	4e-43	8	177	8	169	NAC domain-containing protein 19
3swp_C	4e-43	8	177	8	169	NAC domain-containing protein 19
3swp_D	4e-43	8	177	8	169	NAC domain-containing protein 19
4dul_A	3e-43	8	177	5	166	NAC domain-containing protein 19
4dul_B	3e-43	8	177	5	166	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Binds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269\|PubMed:27021284}.
UniProt	Transcription activator that binds to DNA in promoters of target genes on a specific bipartite motif 5'-[ACG][CA]GT[AG](5-6n)[CT]AC[AG]-3' (PubMed:23340744). Promotes lateral root development (PubMed:16359384). Triggers the expression of senescence-associated genes during age-, salt- and dark-induced senescence through a regulatory network that may involve cross-talk with salt- and H(2)O(2)-dependent signaling pathways (PubMed:9351240, PubMed:15295076, PubMed:20113437, PubMed:21303842). Regulates also genes during seed germination (PubMed:20113437). Regulates positively aging-induced cell death (PubMed:19229035). Involved in age-related resistance (ARR) against Pseudomonas syringae pv. tomato and Hyaloperonospora arabidopsidis (PubMed:19694953). Antagonizes GLK1 and GLK2 transcriptional activity, shifting the balance from chloroplast maintenance towards deterioration during leaf senescence (PubMed:23459204). Promotes the expression of senescence-associated genes, including ENDO1/BFN1, SWEET15/SAG29 and SINA1/At3g13672, during senescence onset (PubMed:23340744). {ECO:0000269\|PubMed:15295076, ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:21303842, ECO:0000269\|PubMed:23340744, ECO:0000269\|PubMed:23459204, ECO:0000269\|PubMed:9351240}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: High levels during senescence (e.g. age-, salt- and dark-related) (PubMed:19229035, PubMed:20113437, PubMed:21511905, PubMed:22930749). By salt stress in an ethylene- and auxin-dependent manner (PubMed:16359384, PubMed:19608714, PubMed:20113437, PubMed:20404534). Induced by H(2)O(2) (PubMed:20404534). Accumulates in response to abscisic acid (ABA), ethylene (ACC) and auxin (NAA) (PubMed:16359384, PubMed:19608714). Repressed by high auxin (IAA) levels (PubMed:21511905). Age-related resistance (ARR)-associated accumulation (PubMed:19694953). Repressed by miR164 (PubMed:19229035). {ECO:0000269\|PubMed:16359384, ECO:0000269\|PubMed:19229035, ECO:0000269\|PubMed:19608714, ECO:0000269\|PubMed:19694953, ECO:0000269\|PubMed:20113437, ECO:0000269\|PubMed:20404534, ECO:0000269\|PubMed:21511905, ECO:0000269\|PubMed:22930749}.
UniProt	INDUCTION: Repressed by the microRNA miR164. {ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:17098808}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025801540.1	2e-80	NAC domain-containing protein 79-like
Swissprot	Q9FKA0	1e-66	NAC92_ARATH; NAC domain-containing protein 92
Swissprot	Q9FLJ2	5e-66	NC100_ARATH; NAC domain-containing protein 100
TrEMBL	A0A1E5V4C4	9e-83	A0A1E5V4C4_9POAL; NAC domain-containing protein 79
STRING	Si030284m	4e-78	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP36207	3	4

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G39610.1	1e-63	NAC domain containing protein 6

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Manacorda CA, et al. Salicylic acid determines differential senescence produced by two Turnip mosaic virus strains involving reactive oxygen species and early transcriptomic changes. Mol. Plant Microbe Interact., 2013. 26(12): p. 1486-98 [PMID:23945002] Khan M,Rozhon W,Poppenberger B The role of hormones in the aging of plants - a mini-review. Gerontology, 2014. 60(1): p. 49-55 [PMID:24135638] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Bohner A,Kojima S,Hajirezaei M,Melzer M,von Wirén N Urea retranslocation from senescing Arabidopsis leaves is promoted by DUR3-mediated urea retrieval from leaf apoplast. Plant J., 2015. 81(3): p. 377-87 [PMID:25440717] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Kim H, et al. Circadian control of ORE1 by PRR9 positively regulates leaf senescence in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(33): p. 8448-8453 [PMID:30065116]