|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Zjn_sc00034.1.g02800.1.sm.mkhc |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
Family |
M-type_MADS |
Protein Properties |
Length: 117aa MW: 13258.8 Da PI: 8.4434 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Zjn_sc00034.1.g02800.1.sm.mkhc | genome | ZGD | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 81.1 | 7.3e-26 | 11 | 60 | 2 | 51 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
rie+k rqv fskRr g++KKA+EL LCdaeva+++fs+ gklyeyss
Zjn_sc00034.1.g02800.1.sm.mkhc 11 RIEDKASRQVRFSKRRSGLFKKAFELALLCDAEVALLVFSPAGKLYEYSS 60
8***********************************************96 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
3kov_A | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-18 | 4 | 73 | 2 | 71 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor involved in the regulation of flowering time under short day (SD) conditions. Functions as promoter of flowering under SD conditions, upstream of EHD1, HD3A and MADS14, but downstream of GIGANTEA (GI). May transmit a SD promotion signal from GI to EHD1. Functions independently of MADS50 to control flowering time. {ECO:0000269|PubMed:17951465}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | BT038349 | 4e-74 | BT038349.1 Zea mays full-length cDNA clone ZM_BFb0228B20 mRNA, complete cds. |
GenBank | EU961677 | 4e-74 | EU961677.1 Zea mays clone 237541 MADS-box transcription factor 8 mRNA, complete cds. |
GenBank | KJ726934 | 4e-74 | KJ726934.1 Zea mays clone pUT3480 MADS transcription factor (MADS69) mRNA, partial cds. |
Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Kim SL,Lee S,Kim HJ,Nam HG,An G
OsMADS51 is a short-day flowering promoter that functions upstream of Ehd1, OsMADS14, and Hd3a. Plant Physiol., 2007. 145(4): p. 1484-94 [PMID:17951465]
|