|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Zjn_sc00026.1.g01710.1.sm.mk |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
|
Family |
M-type_MADS |
Protein Properties |
Length: 95aa MW: 10477.1 Da PI: 10.1516 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Zjn_sc00026.1.g01710.1.sm.mk | genome | ZGD | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 102.5 | 1.5e-32 | 43 | 93 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey++
Zjn_sc00026.1.g01710.1.sm.mk 43 KRIENSTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYAN 93
79***********************************************85 PP
|
3D Structure ? help Back to Top |
|
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 8e-22 | 35 | 93 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AJ430637 | 2e-63 | AJ430637.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m23 gene). |
GenBank | EU960810 | 2e-63 | EU960810.1 Zea mays clone 228787 MADS-box transcription factor 3 mRNA, complete cds. |