PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Zjn_sc00016.1.g02470.1.sm.mkhc

Organism

Zoysia japonica

Taxonomic ID

309978

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia

Family

M-type_MADS

Protein Properties

Length: 116aa MW: 12254.1 Da PI: 10.0782

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Zjn_sc00016.1.g02470.1.sm.mkhc	genome	ZGD	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	95.1	3.1e-30	65	115	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krien+ nrqvtf+kRr g+lKKA+ELSvLCdae+a+++fss+g+lyeys+ Zjn_sc00016.1.g02470.1.sm.mkhc 65 KRIENTPNRQVTFCKRRSGLLKKAYELSVLCDAEIALVVFSSRGRLYEYSN 115 79***********************************************95 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00404	4.4E-30	59	79	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	59	113	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	1.7E-26	60	115	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.6E-33	60	116	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.352	61	116	IPR002100	Transcription factor, MADS-box
CDD	cd00265	8.28E-35	62	116	No hit	No description
Pfam	PF00319	9.6E-26	66	113	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-30	79	94	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-30	94	115	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MHIREMEAAP STDLMSAALT SVGLKQKDPL PSPGTGSVAA AASTAGAAEK AAAAAGNKGK 60 KVEIKRIENT PNRQVTFCKR RSGLLKKAYE LSVLCDAEIA LVVFSSRGRL YEYSNN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
1tqe_Q	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
1tqe_R	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
1tqe_S	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
3mu6_A	3e-20	60	114	3	57	Myocyte-specific enhancer factor 2A
3mu6_B	3e-20	60	114	3	57	Myocyte-specific enhancer factor 2A
3mu6_C	3e-20	60	114	3	57	Myocyte-specific enhancer factor 2A
3mu6_D	3e-20	60	114	3	57	Myocyte-specific enhancer factor 2A
6c9l_A	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
6c9l_B	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
6c9l_C	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
6c9l_D	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
6c9l_E	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
6c9l_F	4e-20	60	114	4	58	Myocyte-specific enhancer factor 2B
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the development of floral organs. Acts as a C-class protein in association with MADS3. Involved in the control of lodicule number (whorl 2), stamen specification (whorl 3), floral meristem determinacy and regulation of the carpel morphogenesis (whorl 4). Plays a more predominant role in floral meristem determinacy than MADS3. {ECO:0000269\|PubMed:16326928}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ430631	2e-69	AJ430631.1 Zea mays partial mRNA for putative MADS-domain transcription factor (m2 gene).
GenBank	KJ728313	2e-69	KJ728313.1 Zea mays clone pUT6593 MADS transcription factor (MADS35) mRNA, partial cds.
GenBank	MZEAGAMOU	2e-69	L81162.2 Zea mays AGAMOUS-like protein (AGAMOUS) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004960599.1	2e-44	MADS-box transcription factor 58
Swissprot	Q2V0P1	4e-37	MAD58_ORYSJ; MADS-box transcription factor 58
TrEMBL	A0A368QCB7	4e-43	A0A368QCB7_SETIT; Uncharacterized protein
TrEMBL	K3ZAE5	4e-44	K3ZAE5_SETIT; Uncharacterized protein
STRING	Si023516m	7e-45	(Setaria italica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP129	38	398

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G18960.1	2e-31	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Cheng CH, et al. A fine physical map of the rice chromosome 5. Mol. Genet. Genomics, 2005. 274(4): p. 337-45 [PMID:16261349] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Sato H,Yoshida K,Mitsuda N,Ohme-Takagi M,Takamizo T Male-sterile and cleistogamous phenotypes in tall fescue induced by chimeric repressors of SUPERWOMAN1 and OsMADS58. Plant Sci., 2012. 183: p. 183-9 [PMID:22195592] Yun D, et al. OsMADS16 genetically interacts with OsMADS3 and OsMADS58 in specifying floral patterning in rice. Mol Plant, 2013. 6(3): p. 743-56 [PMID:23300256] Yan D, et al. Curved chimeric palea 1 encoding an EMF1-like protein maintains epigenetic repression of OsMADS58 in rice palea development. Plant J., 2015. 82(1): p. 12-24 [PMID:25647350] Zheng M, et al. DEFORMED FLORAL ORGAN1 (DFO1) regulates floral organ identity by epigenetically repressing the expression of OsMADS58 in rice (Oryza sativa). New Phytol., 2015. 206(4): p. 1476-90 [PMID:25675970] Chen R, et al. A Gene Expression Profiling of Early Rice Stamen Development that Reveals Inhibition of Photosynthetic Genes by OsMADS58. Mol Plant, 2015. 8(7): p. 1069-89 [PMID:25684654] Hu Y, et al. Interactions of OsMADS1 with Floral Homeotic Genes in Rice Flower Development. Mol Plant, 2015. 8(9): p. 1366-84 [PMID:25917758]