![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016503419.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 125aa MW: 14345.6 Da PI: 7.0513 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 108.6 | 4.7e-34 | 12 | 111 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaC +lr+kC ++C lapyfp++++++f+nv +lFG sn++++l+++++e++ ++++ l+ eA++r ++PvyG++++ +kl+ +e++++el+ XP_016503419.1 12 KCAACTHLRKKCDANCQLAPYFPSNKTEDFQNVYRLFGISNIINMLNSVDDEQKGKMAENLILEAKIRKENPVYGCLAIERKLRLAIEETEKELE 106 5********************************************************************************************** PP DUF260 96 llkee 100 ++++ XP_016503419.1 107 IVQKQ 111 99986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 22.857 | 11 | 112 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.0E-33 | 12 | 109 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MENADPLIST EKCAACTHLR KKCDANCQLA PYFPSNKTED FQNVYRLFGI SNIINMLNSV 60 DDEQKGKMAE NLILEAKIRK ENPVYGCLAI ERKLRLAIEE TEKELEIVQK QNAFCKEMAK 120 SQMQK |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-21 | 13 | 111 | 12 | 110 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-21 | 13 | 111 | 12 | 110 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009629106.1 | 6e-88 | PREDICTED: LOB domain-containing protein 24-like | ||||
Refseq | XP_016503419.1 | 6e-88 | PREDICTED: LOB domain-containing protein 24-like | ||||
TrEMBL | A0A1S4CQX3 | 1e-86 | A0A1S4CQX3_TOBAC; LOB domain-containing protein 24-like | ||||
STRING | XP_009629106.1 | 2e-87 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2866 | 17 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 2e-27 | LOB domain-containing protein 24 |