![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016501699.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | B3 | ||||||||
Protein Properties | Length: 91aa MW: 10699.4 Da PI: 10.6148 | ||||||||
Description | B3 family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | B3 | 38.3 | 2.4e-12 | 1 | 50 | 36 | 87 |
EEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS B3 36 ltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 ++l+de+ r W v++ + ++ +t+GW++F +an++++gD+ F+l+++ XP_016501699.1 1 MILRDEKQRLWPVQV--GPVGHQFSITRGWRQFREANNVQVGDTYKFELIDN 50 579************..999999*************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02362 | 1.4E-10 | 1 | 52 | IPR003340 | B3 DNA binding domain |
CDD | cd10017 | 3.05E-10 | 1 | 60 | No hit | No description |
PROSITE profile | PS50863 | 12.802 | 1 | 61 | IPR003340 | B3 DNA binding domain |
SuperFamily | SSF101936 | 6.08E-14 | 1 | 59 | IPR015300 | DNA-binding pseudobarrel domain |
Gene3D | G3DSA:2.40.330.10 | 4.0E-13 | 1 | 59 | IPR015300 | DNA-binding pseudobarrel domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MILRDEKQRL WPVQVGPVGH QFSITRGWRQ FREANNVQVG DTYKFELIDN GTIPVAHFHC 60 KYLGRMSSIR VVIDNVKKQL VIGKENEHRR I |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016501699.1 | 1e-62 | PREDICTED: B3 domain-containing protein REM1-like | ||||
TrEMBL | A0A1S4CL83 | 2e-61 | A0A1S4CL83_TOBAC; B3 domain-containing protein REM1-like | ||||
STRING | Solyc08g006190.1.1 | 4e-28 | (Solanum lycopersicum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA322 | 15 | 171 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G24700.1 | 5e-07 | B3 family protein |