![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016491828.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 137aa MW: 15841.4 Da PI: 10.2998 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 70.2 | 1.9e-22 | 10 | 53 | 2 | 45 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45 r e +snrqvt++k r gilKKA+E+SvLCd+++++++fs+tgk XP_016491828.1 10 RLETSSNRQVTYCKKRSGILKKAKEISVLCDIDILLLMFSPTGK 53 67899**************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 24.46 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 2.5E-26 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.33E-26 | 2 | 95 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.2E-19 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.2E-18 | 12 | 56 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.2E-19 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 7.2E-19 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010152 | Biological Process | pollen maturation | ||||
GO:0080092 | Biological Process | regulation of pollen tube growth | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 137 aa Download sequence Send to blast |
MGRVRINIRR LETSSNRQVT YCKKRSGILK KAKEISVLCD IDILLLMFSP TGKPTLFQGE 60 RSNFDEIIAK FAQLTPQERA KRKLESLETL RKTFKKLDQD VGVQEFLDAS DPSVEELNNQ 120 VKVLQSRLTD VEKRLSW |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6byy_A | 1e-16 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_B | 1e-16 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_C | 1e-16 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
6byy_D | 1e-16 | 1 | 92 | 1 | 90 | MEF2 CHIMERA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that forms a heterodimer with the MADS-box protein AGL104 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269|PubMed:19211705}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016491828.1 | 2e-95 | PREDICTED: agamous-like MADS-box protein AGL65 isoform X2 | ||||
Swissprot | Q7X9I0 | 1e-58 | AGL65_ARATH; Agamous-like MADS-box protein AGL65 | ||||
TrEMBL | A0A1S4BSQ1 | 4e-94 | A0A1S4BSQ1_TOBAC; agamous-like MADS-box protein AGL65 isoform X2 | ||||
STRING | XP_009615322.1 | 3e-93 | (Nicotiana tomentosiformis) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G18750.1 | 4e-61 | AGAMOUS-like 65 |
Publications ? help Back to Top | |||
---|---|---|---|
|