PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

SBP

Protein Properties

Length: 139aa MW: 14861.6 Da PI: 9.3099

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016486384.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	79.5	5e-25	85	137	1	53
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETT CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhels 53 +CqvegCeadls++k y++rhkvC +hsk+pvv+v+gleqrfCqqCsr h + XP_016486384.1 85 RCQVEGCEADLSDVKAYYSRHKVCATHSKSPVVIVAGLEQRFCQQCSRQHYRH 137 6************************************************9755 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	3.3E-25	79	135	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	20.538	83	139	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	7.46E-24	84	138	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	6.5E-19	86	134	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 139 aa Download sequence Send to blast
MNGLSKSEME LLASASSSTS TTSTSPDSPP NTLKFGQKIY FEHVGPHHPK SATGSSSSPV 60 TGTPAPTTSK KGRGGGVVQG RQPSRCQVEG CEADLSDVKA YYSRHKVCAT HSKSPVVIVA 120 GLEQRFCQQC SRQHYRHEL

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj0_A	2e-16	86	139	6	59	squamosa promoter-binding protein-like 12
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by microRNAs miR157. {ECO:0000305\|PubMed:12202040}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LC073299	0.0	LC073299.1 Nicotiana tabacum NtabSPL9b mRNA for squamosa promoter binding protein NtabSPL9b, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_016486384.1	1e-98	PREDICTED: squamosa promoter-binding-like protein 9
Swissprot	Q9M2Q6	1e-25	SPL15_ARATH; Squamosa promoter-binding-like protein 15
TrEMBL	A0A1S4BBW6	3e-97	A0A1S4BBW6_TOBAC; squamosa promoter-binding-like protein 9
STRING	XP_009612109.1	6e-90	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA4571	22	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G57920.1	1e-23	squamosa promoter binding protein-like 15

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95. Dev. Genes Evol., 2016. 226(1): p. 1-14 [PMID:26635304] Morea EG, et al. Functional and evolutionary analyses of the miR156 and miR529 families in land plants. BMC Plant Biol., 2016. 16: p. 40 [PMID:26841873] Hyun Y, et al. Multi-layered Regulation of SPL15 and Cooperation with SOC1 Integrate Endogenous Flowering Pathways at the Arabidopsis Shoot Meristem. Dev. Cell, 2016. 37(3): p. 254-66 [PMID:27134142] Xu M, et al. Developmental Functions of miR156-Regulated SQUAMOSA PROMOTER BINDING PROTEIN-LIKE (SPL) Genes in Arabidopsis thaliana. PLoS Genet., 2016. 12(8): p. e1006263 [PMID:27541584]