PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana

Family

SBP

Protein Properties

Length: 136aa MW: 15790.5 Da PI: 7.8603

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_016481556.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	139.3	1.1e-43	52	127	2	77
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+e+C+ad+++ak yhrrhkvCe+hskapvvl+sg++qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk++ XP_016481556.1 52 CQIEQCTADMADAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLAEFDEAKRSCRRRLAGHNERRRKTS 127 **************************************************************************87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PIRSF	PIRSF037575	6.8E-59	1	136	IPR017238	Squamosa promoter-binding protein
Gene3D	G3DSA:4.10.1100.10	2.3E-35	45	113	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	32.565	49	126	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	3.83E-40	50	130	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	3.1E-33	52	125	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009911	Biological Process	positive regulation of flower development
GO:0010228	Biological Process	vegetative to reproductive phase transition of meristem
GO:0010229	Biological Process	inflorescence development
GO:0010321	Biological Process	regulation of vegetative phase change
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046872	Molecular Function	metal ion binding

Sequence ? help Back to Top
Protein Sequence Length: 136 aa Download sequence Send to blast
MEDNKWEGKR SMNEAEEEEE EHENVEEDNK RKRVLTLSGR KQSSGGPALP SCQIEQCTAD 60 MADAKPYHRR HKVCEFHSKA PVVLISGIQQ RFCQQCSRFH QLAEFDEAKR SCRRRLAGHN 120 ERRRKTSYDS HGESSS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	5e-41	43	125	2	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00290	DAP	Transfer from AT2G33810	Download

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	LC073301	0.0	LC073301.1 Nicotiana tabacum NtabSPL3b mRNA for squamosa promoter binding protein NtabSPL3b, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009602314.1	1e-97	PREDICTED: squamosa promoter-binding protein 1-like isoform X2
Refseq	XP_016481556.1	1e-97	PREDICTED: squamosa promoter-binding protein 1-like
Swissprot	Q38741	4e-57	SBP1_ANTMA; Squamosa promoter-binding protein 1
TrEMBL	A0A125SZP0	3e-96	A0A125SZP0_TOBAC; Squamosa promoter-binding-like protein
STRING	XP_009602313.1	1e-83	(Nicotiana tomentosiformis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA749	24	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G33810.1	3e-45	squamosa promoter binding protein-like 3

Link Out ? help Back to Top
Entrez Gene	107802557

Publications ? help Back to Top
Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95. Dev. Genes Evol., 2016. 226(1): p. 1-14 [PMID:26635304] Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]