PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016452159.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 151aa MW: 17154.4 Da PI: 5.0719 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.7 | 6.2e-57 | 19 | 114 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqdrflPianvsrimkk+lPanakiskdake+vqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+y+eplk+yl+++r+leg+ XP_016452159.1 19 REQDRFLPIANVSRIMKKALPANAKISKDAKEIVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYIEPLKIYLQRFRDLEGQ 113 89*******************************************************************************************98 PP NF-YB 97 k 97 k XP_016452159.1 114 K 114 6 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.5E-54 | 13 | 118 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 2.33E-40 | 21 | 118 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.1E-28 | 24 | 88 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 7.6E-21 | 52 | 70 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 55 | 71 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 7.6E-21 | 71 | 89 | No hit | No description |
PRINTS | PR00615 | 7.6E-21 | 90 | 108 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 151 aa Download sequence Send to blast |
MADSDNESGG QRESESSLRE QDRFLPIANV SRIMKKALPA NAKISKDAKE IVQECVSEFI 60 SFITGEASDK CQREKRKTIN GDDLLWAMTT LGFEEYIEPL KIYLQRFRDL EGQKSTMVGI 120 QDKENGGTVN MGSYVEDYGM IMMGQHHQRH V |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 1e-47 | 17 | 109 | 1 | 93 | NF-YB |
4awl_B | 1e-47 | 17 | 109 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 1e-47 | 17 | 109 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT013228 | 6e-95 | BT013228.1 Lycopersicon esculentum clone 134470F, mRNA sequence. | |||
GenBank | HG975519 | 6e-95 | HG975519.1 Solanum lycopersicum chromosome ch07, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009602971.1 | 1e-111 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Refseq | XP_016452159.1 | 1e-111 | PREDICTED: nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | O23310 | 1e-71 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | A0A1S3YIU6 | 1e-109 | A0A1S3YIU6_TOBAC; nuclear transcription factor Y subunit B-3-like | ||||
STRING | XP_009602971.1 | 1e-110 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 6e-74 | nuclear factor Y, subunit B3 |
Publications ? help Back to Top | |||
---|---|---|---|
|