![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016433751.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 140aa MW: 15997.8 Da PI: 7.4385 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 136.3 | 9e-43 | 56 | 131 | 2 | 77 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 Cq+e+C+ad+++ak+yhrrhkvCe+h+kap+vl+ gl+qrfCqqCsrfh+l efDe+krsCrrrLa+hnerrrk++ XP_016433751.1 56 CQIEDCTADMANAKTYHRRHKVCEFHAKAPAVLIGGLRQRFCQQCSRFHQLGEFDEAKRSCRRRLAGHNERRRKSS 131 **************************************************************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PIRSF | PIRSF037575 | 9.4E-59 | 1 | 140 | IPR017238 | Squamosa promoter-binding protein |
Gene3D | G3DSA:4.10.1100.10 | 3.4E-36 | 48 | 117 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 32.47 | 53 | 130 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.86E-39 | 54 | 133 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 5.9E-33 | 56 | 129 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009908 | Biological Process | flower development | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 140 aa Download sequence Send to blast |
METSKWEEKR SMTAAEMEEE DDEEDEDVVE DNKRKRVLTH SGRKVPGGEG SKLPSCQIED 60 CTADMANAKT YHRRHKVCEF HAKAPAVLIG GLRQRFCQQC SRFHQLGEFD EAKRSCRRRL 120 AGHNERRRKS SCDSPGEGSS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 8e-39 | 47 | 129 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KT717963 | 1e-106 | KT717963.1 Petunia x hybrida squamosa promoter-binding protein 1 mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009622641.1 | 1e-100 | PREDICTED: squamosa promoter-binding protein 1 | ||||
Refseq | XP_016433751.1 | 1e-100 | PREDICTED: squamosa promoter-binding protein 1-like | ||||
Swissprot | Q38741 | 1e-54 | SBP1_ANTMA; Squamosa promoter-binding protein 1 | ||||
TrEMBL | A0A1S3X1Q3 | 8e-99 | A0A1S3X1Q3_TOBAC; Squamosa promoter-binding-like protein | ||||
STRING | XP_009622640.1 | 1e-99 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA749 | 24 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G33810.1 | 1e-44 | squamosa promoter binding protein-like 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|