![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_016433116.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 136aa MW: 15048.8 Da PI: 10.2173 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 97.7 | 2.2e-30 | 67 | 130 | 2 | 65 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65 g+kdrhsk+ T++g+RdRRvRls+++a++f+dLqd+LG+d++ k +eWLl++ p+i el+++ XP_016433116.1 67 SGGKDRHSKVWTSKGLRDRRVRLSVNTAIQFYDLQDRLGYDQPNKDVEWLLKATAPSISELPSL 130 689*********************************************************9986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 4.0E-30 | 68 | 130 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 30.06 | 69 | 127 | IPR017887 | Transcription factor TCP subgroup |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 136 aa Download sequence Send to blast |
MEAWGKNLTN VTSLGETRTK KSCNGNGRFE SQDENETVKG SHGLGGGGVS RLCGWPSNRI 60 VRVSRASGGK DRHSKVWTSK GLRDRRVRLS VNTAIQFYDL QDRLGYDQPN KDVEWLLKAT 120 APSISELPSL NVFPDT |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 8e-24 | 74 | 128 | 1 | 55 | Putative transcription factor PCF6 |
5zkt_B | 8e-24 | 74 | 128 | 1 | 55 | Putative transcription factor PCF6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). Participates in ovule develpment (PubMed:25378179). Promotes light-regulated transcription of CHS, CAB, HYH and HY5. Regulates positively photomorphogenesis (e.g. hypocotyl elongation inhibition and cotyledon opening in response to blue light) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179, ECO:0000269|PubMed:26596765}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Repressed by the miRNA miR-JAW (PubMed:12931144). Induced by blue light. Stabilized by light but labile in darkness due to proteasome-dependent proteolysis (at protein level) (PubMed:26596765). {ECO:0000269|PubMed:12931144, ECO:0000269|PubMed:26596765}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_016433116.1 | 9e-97 | PREDICTED: transcription factor TCP2-like | ||||
Swissprot | Q93V43 | 2e-37 | TCP2_ARATH; Transcription factor TCP2 | ||||
TrEMBL | A0A1S3X005 | 2e-95 | A0A1S3X005_TOBAC; transcription factor TCP2-like | ||||
STRING | XP_009762097.1 | 5e-94 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA2464 | 22 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18390.2 | 2e-39 | TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 2 |
Publications ? help Back to Top | |||
---|---|---|---|
|