![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015902519.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 114aa MW: 13036 Da PI: 5.1929 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 42 | 2.2e-13 | 38 | 78 | 4 | 45 |
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 W ++E ll+++++++G ++W+ +a+++g +++ qc+++++ XP_015902519.1 38 WNADEGSLLLEGIEMYGFRNWSEVAEHVG-TKSKAQCINHYN 78 *****************************.***********8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 7.48E-13 | 32 | 80 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51293 | 18.073 | 33 | 85 | IPR017884 | SANT domain |
SMART | SM00717 | 1.7E-9 | 34 | 83 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.2E-12 | 37 | 78 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 4.8E-10 | 38 | 81 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 4.33E-12 | 38 | 78 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 114 aa Download sequence Send to blast |
MEHEKFFFTE IKQGKEIANP KGLFPIDNLA YPLICPDWNA DEGSLLLEGI EMYGFRNWSE 60 VAEHVGTKSK AQCINHYNAT ICMNSPFFPL LDLSHVMKKS REELLAMAKE LKEG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Required for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015902519.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015900772.1 | 1e-44 | transcriptional adapter ADA2-like isoform X1 | ||||
Refseq | XP_024923007.1 | 1e-44 | transcriptional adapter ADA2-like isoform X1 | ||||
Swissprot | Q75LL6 | 1e-36 | TADA2_ORYSJ; Transcriptional adapter ADA2 | ||||
TrEMBL | A0A061E8N5 | 2e-40 | A0A061E8N5_THECC; Transcriptional adapter | ||||
TrEMBL | A0A061E9Q0 | 2e-40 | A0A061E9Q0_THECC; Transcriptional adapter | ||||
TrEMBL | A0A061EGE0 | 2e-40 | A0A061EGE0_THECC; Transcriptional adapter | ||||
TrEMBL | A0A2P5W492 | 2e-40 | A0A2P5W492_GOSBA; Uncharacterized protein | ||||
STRING | XP_008347821.1 | 2e-42 | (Malus domestica) | ||||
STRING | cassava4.1_004777m | 5e-40 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1537 | 17 | 26 |
Publications ? help Back to Top | |||
---|---|---|---|
|