PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus

Family

SBP

Protein Properties

Length: 172aa MW: 19646.3 Da PI: 4.976

Description

SBP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_015889537.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SBP	123.6	8.6e-39	81	158	1	78
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 +Cq+++C dl+ ak yh+rhkvCe h+ka+vvlv+gl+qrfCqqCsrfhe+sefD +k+sCr+rLa+hn rrrk+++ XP_015889537.1 81 CCQADECGLDLKLAKPYHKRHKVCERHAKAAVVLVNGLRQRFCQQCSRFHEISEFDGNKKSCRERLAGHNLRRRKAHS 158 6**************************************************************************875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:4.10.1100.10	4.3E-31	76	143	IPR004333	Transcription factor, SBP-box
PROSITE profile	PS51141	29.957	79	156	IPR004333	Transcription factor, SBP-box
SuperFamily	SSF103612	2.88E-35	80	160	IPR004333	Transcription factor, SBP-box
Pfam	PF03110	7.8E-32	82	155	IPR004333	Transcription factor, SBP-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 172 aa Download sequence Send to blast
MSVSRGSIGR QKEEEEEEEE NDNEEAEDQG ETESDDDEED ESDGVDLEED RRKRVMIRVV 60 SGEGRGISSS TAASYSSSSL CCQADECGLD LKLAKPYHKR HKVCERHAKA AVVLVNGLRQ 120 RFCQQCSRFH EISEFDGNKK SCRERLAGHN LRRRKAHSDS QERLDRNNQR SE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ul4_A	1e-30	72	155	1	84	squamosa promoter binding protein-like 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene.
UniProt	Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000269\|PubMed:16554053}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_015889537.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015889537.1	1e-120	squamosa promoter-binding protein 1-like
Refseq	XP_024931878.1	1e-120	squamosa promoter-binding protein 1-like
Swissprot	Q38741	1e-35	SBP1_ANTMA; Squamosa promoter-binding protein 1
Swissprot	Q9S7P5	1e-32	SPL12_ARATH; Squamosa promoter-binding-like protein 12
TrEMBL	A0A2I6SEV3	2e-46	A0A2I6SEV3_9ROSI; SBP-box transcription factor (Fragment)
STRING	VIT_04s0210g00170.t01	4e-45	(Vitis vinifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF535	34	153

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G53160.2	5e-33	squamosa promoter binding protein-like 4

Publications ? help Back to Top
Jung S, et al. Synteny conservation between the Prunus genome and both the present and ancestral Arabidopsis genomes. BMC Genomics, 2006. 7: p. 81 [PMID:16615871] Jorgensen SA,Preston JC Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis. Mol. Phylogenet. Evol., 2014. 73: p. 129-39 [PMID:24508602] Chao LM, et al. Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage. Mol Plant, 2017. 10(5): p. 735-748 [PMID:28400323] Klein J,Saedler H,Huijser P A new family of DNA binding proteins includes putative transcriptional regulators of the Antirrhinum majus floral meristem identity gene SQUAMOSA. Mol. Gen. Genet., 1996. 250(1): p. 7-16 [PMID:8569690]