![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015868131.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 210aa MW: 24195.2 Da PI: 10.0504 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 63 | 6e-20 | 28 | 75 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT++Ed +l++a++ +G + WktIa++ g++R++k+c++rw++yl XP_015868131.1 28 KGAWTADEDRILAEAIAIHGAKKWKTIAAKSGLNRCGKSCRLRWLNYL 75 79********************************************97 PP | |||||||
2 | Myb_DNA-binding | 50.7 | 4.2e-16 | 81 | 126 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ + +E++l+++++k+lG++ W++Ia +++ gRt++++k++w+++l XP_015868131.1 81 RGNISDQEEDLILRLHKLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 126 78999*****************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 26.794 | 23 | 79 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.03E-29 | 26 | 122 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.7E-16 | 27 | 77 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.6E-17 | 28 | 75 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.7E-23 | 29 | 82 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.08E-11 | 30 | 75 | No hit | No description |
SMART | SM00717 | 1.9E-15 | 80 | 128 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 20.918 | 80 | 130 | IPR017930 | Myb domain |
Pfam | PF00249 | 1.8E-14 | 81 | 126 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 6.3E-25 | 83 | 131 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.79E-10 | 85 | 126 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009957 | Biological Process | epidermal cell fate specification | ||||
GO:0010090 | Biological Process | trichome morphogenesis | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0048629 | Biological Process | trichome patterning | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 210 aa Download sequence Send to blast |
MSTMRDDESI LKQEGNMRKV STKKEVNKGA WTADEDRILA EAIAIHGAKK WKTIAAKSGL 60 NRCGKSCRLR WLNYLRPNIK RGNISDQEED LILRLHKLLG NRWSLIAGRL PGRTDNEIKN 120 YWNSHLSKKI KQQKEKQSST IGSTRKSSRS GQKISNVVQN KQEETAKKEG DDHSNSTNNF 180 DVDEFFDFSN EEPLNLEWIN KFLQVDEGYN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1h8a_C | 2e-28 | 25 | 130 | 24 | 128 | MYB TRANSFORMING PROTEIN |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator, when associated with BHLH2/EGL3/MYC146 or BHLH12/MYC1. Involved in epidermal cell fate specification in roots and hypocotyl. Together with GL3 or BHLH2, promotes the formation of non-hair developing cells (atrichoblasts) et the N position in root epidermis. Regulates stomata spatial distribution in hypocotyls. Binds to the WER-binding sites (WBS) promoter regions and activates the transcription of target genes such as GL2 and of CPC. {ECO:0000269|PubMed:10589676, ECO:0000269|PubMed:11585796, ECO:0000269|PubMed:14627722, ECO:0000269|PubMed:15361138, ECO:0000269|PubMed:15795220, ECO:0000269|PubMed:16207757}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015868131.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Transcriptional activation correlates with reduced histone acetylation on H3 and H4 mediated by HDA18 in N cells. Repressed by CPC in hair cells (H position). {ECO:0000269|PubMed:11910008, ECO:0000269|PubMed:16176989}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015868131.1 | 1e-154 | transcription factor MYB114-like | ||||
Swissprot | Q9SEI0 | 8e-55 | WER_ARATH; Transcription factor WER | ||||
TrEMBL | A0A061GJK0 | 1e-94 | A0A061GJK0_THECC; Myb domain protein 23 | ||||
STRING | EOY27239 | 2e-95 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2148 | 32 | 88 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G40330.1 | 5e-53 | myb domain protein 23 |