![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_015867081.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rhamnaceae; Paliureae; Ziziphus
|
||||||||
Family | CPP | ||||||||
Protein Properties | Length: 112aa MW: 12844.5 Da PI: 8.145 | ||||||||
Description | CPP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCR | 44.7 | 2.7e-14 | 44 | 83 | 2 | 42 |
TCR 2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 ++++C+Ck++kClk+YC Cfa+g +C+ C+C dC+N+ e+ XP_015867081.1 44 RHRQCHCKQTKCLKLYCVCFASGYYCNG-CNCVDCHNNVEN 83 5789************************.********9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM01114 | 4.4E-13 | 43 | 83 | IPR033467 | Tesmin/TSO1-like CXC domain |
PROSITE profile | PS51634 | 16.733 | 44 | 112 | IPR005172 | CRC domain |
Pfam | PF03638 | 2.6E-11 | 46 | 80 | IPR005172 | CRC domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MQSLTMRDSD RHSPTQIPLS KSNEELPKSQ AQVYVKGDNG AVKRHRQCHC KQTKCLKLYC 60 VCFASGYYCN GCNCVDCHNN VENEDARQEA VEIILERNPN AYRLKSVTFS LW |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a role in development of both male and female reproductive tissues. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_015867081.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015867315.2 | 8e-71 | protein tesmin/TSO1-like CXC 6 | ||||
Swissprot | Q9SL70 | 8e-28 | TCX6_ARATH; Protein tesmin/TSO1-like CXC 6 | ||||
TrEMBL | A0A0D2UC94 | 2e-29 | A0A0D2UC94_GOSRA; Uncharacterized protein | ||||
TrEMBL | A0A1U8PX41 | 1e-29 | A0A1U8PX41_GOSHI; protein tesmin/TSO1-like CXC 6 isoform X1 | ||||
TrEMBL | A0A2P5XSX4 | 1e-29 | A0A2P5XSX4_GOSBA; Uncharacterized protein | ||||
TrEMBL | A0A2R6S1C8 | 2e-30 | A0A2R6S1C8_ACTCH; Protein tesmin/TSO1-like | ||||
STRING | Gorai.010G108300.1 | 3e-30 | (Gossypium raimondii) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2626 | 33 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G20110.1 | 4e-30 | Tesmin/TSO1-like CXC domain-containing protein |