 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
XP_013892193.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
|
| Family |
MYB |
| Protein Properties |
Length: 113aa MW: 13294.6 Da PI: 10.1604 |
| Description |
MYB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| XP_013892193.1 | genome | BU | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 43.9 | 5.6e-14 | 9 | 53 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
W Ede+l+ av ++G ++W++I++ + ++++kqck rw+ +l
XP_013892193.1 9 IWKNTEDEILKAAVMKYGLNQWARISSLLV-RKSAKQCKARWYEWL 53
5999**************************.************986 PP
|
| 2 | Myb_DNA-binding | 38.8 | 2.1e-12 | 60 | 103 | 2 | 48 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
WT eEde+l+++ k+l++ W+tIa +g Rt+ qc +r+ k+l
XP_013892193.1 60 TEWTREEDEKLLHLAKLLPTQ-WRTIAPIVG--RTPAQCLERYEKLL 103
68*****************99.********8..**********9986 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0009870 | Biological Process | defense response signaling pathway, resistance gene-dependent |
| GO:0010204 | Biological Process | defense response signaling pathway, resistance gene-independent |
| GO:0042742 | Biological Process | defense response to bacterium |
| GO:0050832 | Biological Process | defense response to fungus |
| GO:0009507 | Cellular Component | chloroplast |
| GO:0003677 | Molecular Function | DNA binding |
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 5mqf_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 5xjc_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 5yzg_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 5z56_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 5z57_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 5z58_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 6ff4_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 6ff7_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 6icz_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 6id0_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 6id1_L | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| 6qdv_O | 2e-59 | 2 | 111 | 3 | 112 | Cell division cycle 5-like protein |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Component of the MAC complex that probably regulates defense responses through transcriptional control and thereby is essential for plant innate immunity. Possesses a sequence specific DNA sequence 'CTCAGCG' binding activity. Involved in mRNA splicing and cell cycle control. May also play a role in the response to DNA damage. {ECO:0000250|UniProtKB:Q99459, ECO:0000269|PubMed:17298883, ECO:0000269|PubMed:17575050, ECO:0000269|PubMed:8917598}. |
