PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantTFDB

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Orthologous Group |

Basic Information? help Back to Top

TF ID

XP_013891688.1

Organism

Monoraphidium neglectum

Taxonomic ID

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium

Family

Protein Properties

Length: 89aa MW: 10228.3 Da PI: 7.6139

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013891688.1	genome	BU	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	63.2	5.3e-20	30	75	2	47
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 W++eEd +l+++v+++G +W+ Ia++mg+gR +k+c++rw++ XP_013891688.1 30 ATWSPEEDSRLLELVHRYGAQNWTVIASHMGNGRNGKSCRLRWFNQ 75 58*****************************************996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.696	24	80	IPR017930	Myb domain
SuperFamily	SSF46689	1.86E-19	25	89	IPR009057	Homeodomain-like
SMART	SM00717	7.2E-16	28	78	IPR001005	SANT/Myb domain
Pfam	PF00249	8.6E-19	30	76	IPR001005	SANT/Myb domain
CDD	cd00167	1.40E-13	31	74	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.4E-23	31	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MRGAYRGDDS DSKSSGTDER HMGSAMLKRA TWSPEEDSRL LELVHRYGAQ NWTVIASHMG 60 NGRNGKSCRL RWFNQLDPRV NKEPFTEDE

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1mse_C	5e-17	26	89	1	63	C-Myb DNA-Binding Domain
1msf_C	5e-17	26	89	1	63	C-Myb DNA-Binding Domain
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Acts as a cell-specific local repressor of quiescent center (QC) self-renewal by cell divisions in the primary root. Counteracts brassinosteroid (BR)-mediated cell division in the QC cells (PubMed:24981610). Regulates maternally seed size, especially before the heart stage, promoting both endothelial cells expansion and cell number in the outer integument layer of the seed coat (PubMed:23911125). Modulates the expression of genes involved in cell wall metabolism such as cell division and expansion (PubMed:23911125, PubMed:24981610). Negative regulator of flowering via the repression of FT transcription (PubMed:25343985). {ECO:0000269\|PubMed:23911125, ECO:0000269\|PubMed:24981610, ECO:0000269\|PubMed:25343985}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Levels follow a circadian cycle with a progressive decrease during the day time (at protein level) (PubMed:25343985). Down-regulated by brassinosteroids (BRs) in a dose- and time-dependent manner. Repressed by BES1. Auto-activation of expression (PubMed:24981610). Targeted to 26S proteasomal degradation by the CULLIN3 (CUL3)-based E3 ligases CRL3(BPMs) (PubMed:25343985). {ECO:0000269\|PubMed:24981610, ECO:0000269\|PubMed:25343985}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013891688.1	8e-62	Transcription factor MYB44, partial
Swissprot	Q6R053	2e-21	MYB56_ARATH; Transcription factor MYB56
TrEMBL	A0A0D2K9G9	2e-60	A0A0D2K9G9_9CHLO; Transcription factor MYB44 (Fragment)
STRING	Gorai.013G196500.1	6e-22	(Gossypium raimondii)
STRING	PP1S74_264V6.1	1e-21	(Physcomitrella patens)
STRING	PP1S91_13V6.1	2e-21	(Physcomitrella patens)
STRING	fgenesh2_kg.6__1780__AT5G17800.1	9e-22	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Chlorophytae	OGCP15	16	114

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G17800.1	2e-23	myb domain protein 56

Link Out ? help Back to Top
Entrez Gene	25732941

Publications ? help Back to Top
Bogen C, et al. Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production. BMC Genomics, 2013. 14: p. 926 [PMID:24373495] Chen L,Bernhardt A,Lee J,Hellmann H Identification of Arabidopsis MYB56 as a novel substrate for CRL3BPM E3 ligases. Mol Plant, 2015. [PMID:25343985] Frigola D,Caño-Delgado AI,Ibañes M Methods for Modeling Brassinosteroid-Mediated Signaling in Plant Development. Methods Mol. Biol., 2017. 1564: p. 103-120 [PMID:28124249] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Jeong CY, et al. AtMyb56 Regulates Anthocyanin Levels via the Modulation of AtGPT2 Expression in Response to Sucrose in Arabidopsis. Mol. Cells, 2018. 41(4): p. 351-361 [PMID:29487277]