![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013635201.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 176aa MW: 20430.1 Da PI: 8.323 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.7 | 2.1e-32 | 94 | 152 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk++ +prsYYrCt+++C+vkk+v+r a+dpk++++tYeg Hnh+ XP_013635201.1 94 LDDGYRWRKYGQKSVKNNGHPRSYYRCTYHTCNVKKQVQRLAKDPKIIVTTYEGIHNHP 152 59********************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.2E-32 | 81 | 152 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.48E-28 | 86 | 153 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.402 | 89 | 154 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.0E-37 | 94 | 153 | IPR003657 | WRKY domain |
Pfam | PF03106 | 3.9E-26 | 95 | 152 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MERQDIIPPT LSLDVENNDK TFSSFVDETL MMMPSLALPG EVEPSSSSWC PTSFHMPTQP 60 PENDQIGDQG KKKDKRSRKV PRIEFHTRSD DDVLDDGYRW RKYGQKSVKN NGHPRSYYRC 120 TYHTCNVKKQ VQRLAKDPKI IVTTYEGIHN HPCEKLMETL NPLLRQLQFL SSFSNL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 3e-26 | 87 | 151 | 10 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 3e-26 | 87 | 151 | 10 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00539 | DAP | Transfer from AT5G41570 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013635201.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF430042 | 0.0 | KF430042.1 Brassica rapa WRKY transcription factor 24 (WRKY24) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013635201.1 | 1e-131 | PREDICTED: probable WRKY transcription factor 24 | ||||
Refseq | XP_013743457.1 | 1e-131 | probable WRKY transcription factor 24 | ||||
Refseq | XP_013746877.1 | 1e-131 | probable WRKY transcription factor 24 | ||||
Swissprot | Q9FFS3 | 4e-98 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
TrEMBL | A0A078I3P2 | 1e-130 | A0A078I3P2_BRANA; BnaCnng11190D protein | ||||
TrEMBL | A0A0D3C0H4 | 1e-130 | A0A0D3C0H4_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6C9J5 | 1e-130 | A0A3P6C9J5_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g142200.1 | 1e-131 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM509 | 28 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G41570.1 | 8e-81 | WRKY DNA-binding protein 24 |