PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013632261.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 173aa MW: 18963.1 Da PI: 7.5058 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 180.8 | 1.2e-56 | 24 | 120 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 vreqdrflPianvsrimk+ lPan+ki+kdake++qecvsefisfvtseasdkcqrekrktingddllwa+atlGfe+y+eplk+yl++yre+eg XP_013632261.1 24 VREQDRFLPIANVSRIMKRGLPANGKIAKDAKEILQECVSEFISFVTSEASDKCQREKRKTINGDDLLWAMATLGFEEYIEPLKLYLTRYRETEG 118 69********************************************************************************************* PP NF-YB 96 ek 97 ++ XP_013632261.1 119 DS 120 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.3E-54 | 20 | 142 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 4.79E-40 | 27 | 135 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.7E-27 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.7E-21 | 58 | 76 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.7E-21 | 77 | 95 | No hit | No description |
PRINTS | PR00615 | 1.7E-21 | 96 | 114 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 173 aa Download sequence Send to blast |
MMAESQAKSP GGGESPRSSS SSHVREQDRF LPIANVSRIM KRGLPANGKI AKDAKEILQE 60 CVSEFISFVT SEASDKCQRE KRKTINGDDL LWAMATLGFE EYIEPLKLYL TRYRETEGDS 120 KGSARGGDAN AKRDGQSSQN GQFSQLAHQG SYPQGPYGNS QAQHMMVPMP GTD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1n1j_A | 3e-47 | 25 | 115 | 3 | 93 | NF-YB |
4awl_B | 3e-47 | 25 | 115 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
4csr_A | 3e-47 | 25 | 115 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013632261.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK353083 | 1e-134 | AK353083.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-13-K14. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013632258.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
Refseq | XP_013632259.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
Refseq | XP_013632261.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
Refseq | XP_013632262.1 | 1e-128 | PREDICTED: nuclear transcription factor Y subunit B-8-like | ||||
Swissprot | Q8VYK4 | 1e-103 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | A0A0D3C4P7 | 1e-126 | A0A0D3C4P7_BRAOL; Uncharacterized protein | ||||
STRING | Bo4g186630.1 | 1e-127 | (Brassica oleracea) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 1e-100 | nuclear factor Y, subunit B8 |
Publications ? help Back to Top | |||
---|---|---|---|
|