PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013622117.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 255aa MW: 28630.2 Da PI: 7.825 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 22.5 | 2.6e-07 | 28 | 73 | 3 | 46 |
SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46 WT+eE + + +a + + + +W +Ia++++ g+t ++ + k XP_013622117.1 28 VWTKEENKMFERALAIYAEDspdRWFSIASMIP-GKTVFDVMKQYSK 73 7*****************99*************.***9999888876 PP | |||||||
2 | Myb_DNA-binding | 38.8 | 2.2e-12 | 124 | 168 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +WT eE+ +++ + ++G+g+W+ I+r + +t+ q+ s+ qky XP_013622117.1 124 PWTDEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKY 168 8*****************************99************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51293 | 8.649 | 24 | 77 | IPR017884 | SANT domain |
SMART | SM00717 | 8.0E-8 | 25 | 77 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 5.2E-4 | 26 | 73 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 3.3E-11 | 27 | 81 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.9E-6 | 28 | 73 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.57E-7 | 29 | 74 | No hit | No description |
PROSITE profile | PS51294 | 18.612 | 117 | 173 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.42E-15 | 119 | 172 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.3E-17 | 120 | 172 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 7.8E-10 | 121 | 171 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.9E-10 | 121 | 168 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.05E-8 | 124 | 168 | No hit | No description |
Pfam | PF00249 | 1.4E-9 | 124 | 168 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 255 aa Download sequence Send to blast |
METLHPLSHV PISDNRFVVQ DMMSSSSVWT KEENKMFERA LAIYAEDSPD RWFSIASMIP 60 GKTVFDVMKQ YSKLEEDVSD IEAGRVPIPG YPSASSPLGF EPDTCRKRPS GGRGSDHDRK 120 KGVPWTDEEH RRFLLGLLKY GKGDWRNISR NFVVSKTPTQ VASHAQKYYL RQLSGAKDKR 180 RPSIHDFTTV NLINANLNRS ISDHRDILPD LGFVDKDGAE EGLMFLSQNH MFSPSSSPFD 240 AAVRFAGANA FSATS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
2cjj_A | 2e-16 | 29 | 91 | 11 | 73 | RADIALIS |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected in the apical inflorescence meristem, in bract primordia arising in its periphery and in floral meristems produced in the axils of bracts (stages 0-3). From stage 3 to stage 8, detected in all floral organs irrespective of their dorsoventral positions. From stage 9, barely detectable in bracts, sepals, and stamens. In the corolla, however, expression was maintained and enhanced in some regions. Within ventral and lateral petals at stage 9, asymmetric pattern of expression with high levels of transcripts in the inner epidermis of the furrow and very reduced levels in the remaining cell layers. In the dorsal petals, from stage 9 onward, detected but with a more even distribution across cell layers than in the ventral petal. {ECO:0000269|PubMed:11937495}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Involved in the dorsovental asymmetry of flowers. Promotes ventral identity. {ECO:0000269|PubMed:11937495, ECO:0000269|PubMed:9118809}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00347 | DAP | Transfer from AT3G11280 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013622117.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013622117.1 | 0.0 | PREDICTED: transcription factor DIVARICATA-like | ||||
Swissprot | Q8S9H7 | 3e-73 | DIV_ANTMA; Transcription factor DIVARICATA | ||||
TrEMBL | A0A0D3AEH7 | 0.0 | A0A0D3AEH7_BRAOL; Uncharacterized protein | ||||
STRING | Bo1g141120.1 | 0.0 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4340 | 26 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G11280.2 | 1e-160 | MYB family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|