PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

NAC

Protein Properties

Length: 259aa MW: 29622.9 Da PI: 8.6661

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013618408.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	163.5	7.5e-51	11	134	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 ppGfrFhPtdeelv yL++k++++++ + +i+e+d+y+++PwdLp ++ +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ + XP_013618408.1 11 PPGFRFHPTDEELVLMYLCRKCASQPIAA-PIITELDLYRYDPWDLPDMALYGEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGR-- 102 9***********************999.88***********6666689*********************************98.. PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 + vg+kk Lvfy+g+ p+gekt+W+mheyrl XP_013618408.1 103 PRPVGIKKALVFYSGKPPRGEKTNWIMHEYRL 134 789*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	3.66E-61	6	160	IPR003441	NAC domain
PROSITE profile	PS51005	59.783	10	160	IPR003441	NAC domain
Pfam	PF02365	8.2E-27	11	134	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 259 aa Download sequence Send to blast
MMKAGADLQF PPGFRFHPTD EELVLMYLCR KCASQPIAAP IITELDLYRY DPWDLPDMAL 60 YGEKEWYFFS PRDRKYPNGS RPNRAAGTGY WKATGADKPI GRPRPVGIKK ALVFYSGKPP 120 RGEKTNWIMH EYRLADVDRS VRKGNSLRLD DWVLCRIYNK KGVIEKRRSE VENGHVTAPV 180 MMNFDKPEMI GGSSCSDQQV VSPEFTCEAK TEPSRLSNAL DFPFNYVDAI ADNEIVSRLL 240 SGNQMWSTLD PLVVRQRTF

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	3e-78	4	166	9	174	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in germinating seeds, roots, leaf veins, open flowers and silique stalks. {ECO:0000269\|PubMed:27388337}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013618408.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY245886	0.0	AY245886.1 Brassica napus NAC-domain protein 14 (NAC14) mRNA, complete cds.
GenBank	KC966751	0.0	KC966751.1 Brassica napus NAC transcription factor 32 (NAC32.1) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013618408.1	0.0	PREDICTED: NAC domain-containing protein 2
Swissprot	Q9CAR0	1e-157	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A0D3AR78	0.0	A0A0D3AR78_BRAOL; Uncharacterized protein
STRING	Bo2g092550.1	0.0	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM190	28	276

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	1e-160	NAC domain containing protein 32

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]