PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MYB

Protein Properties

Length: 308aa MW: 34312.4 Da PI: 4.9022

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013616108.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.6	2.5e-17	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEd++l+ v+++G W+t +++ g++R++k+c++rw +yl XP_013616108.1 14 KGAWTPEEDQRLIAFVQLHGESGWRTLPEKAGLKRCGKSCRLRWANYL 61 79********************************************97 PP
2	Myb_DNA-binding	50.1	6.4e-16	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg +T+eEd+ ++++++++G++ W++Ia + gRt++++k++w++ XP_013616108.1 67 RGEFTPEEDDTIIKLHALMGNK-WAAIATSLA-GRTDNEIKNYWNTN 111 899*****************.*****.*********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	16.634	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	4.12E-29	11	108	IPR009057	Homeodomain-like
SMART	SM00717	2.2E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.1E-15	14	61	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.6E-23	15	68	IPR009057	Homeodomain-like
CDD	cd00167	1.81E-9	16	61	No hit	No description
PROSITE profile	PS51294	25.277	62	116	IPR017930	Myb domain
SMART	SM00717	1.8E-16	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	5.0E-15	67	112	IPR001005	SANT/Myb domain
CDD	cd00167	1.46E-11	69	112	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.6E-26	69	116	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 308 aa Download sequence Send to blast
MVRTPCCKEE GIRKGAWTPE EDQRLIAFVQ LHGESGWRTL PEKAGLKRCG KSCRLRWANY 60 LKPDIKRGEF TPEEDDTIIK LHALMGNKWA AIATSLAGRT DNEIKNYWNT NLKKRLTQKG 120 LDPTTHKPIN PTDQTGFEPK VHKLGSSSCA RLLNHVARKY AGDLNRDLLT GIIIGNSSNI 180 AEGSQNSVEV DSPTESSTFT LLNKAAARSS AVTSFLTNNM SSSSGLSNNC TLADNLDLFF 240 SNEEISDMSM NVDNVCIMEE LRDILSYGGA DAGDVKDLPE FDVTDGMEFL GSWNVEDDLD 300 LENYYWFR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	1e-27	14	116	7	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in trichomes. {ECO:0000269\|PubMed:23115560}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in tryptophan gene activation and in indole-3-acetic acid (IAA) and indolic glucosinolates (IG) biosynthesis. Acts as a direct transcriptional activator of both Trp synthesis genes and Trp secondary metabolism genes. {ECO:0000269\|PubMed:15579661, ECO:0000269\|PubMed:23580754, ECO:0000269\|PubMed:23943862, ECO:0000269\|PubMed:9576939}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013616108.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by herbivory. {ECO:0000269\|PubMed:23943862}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013616102.1	0.0	PREDICTED: transcription factor MYB34-like
Refseq	XP_013616103.1	0.0	PREDICTED: transcription factor MYB34-like
Refseq	XP_013616104.1	0.0	PREDICTED: transcription factor MYB34-like
Refseq	XP_013616105.1	0.0	PREDICTED: transcription factor MYB34-like
Refseq	XP_013616107.1	0.0	PREDICTED: transcription factor MYB34-like
Refseq	XP_013616108.1	0.0	PREDICTED: transcription factor MYB34-like
Swissprot	O64399	1e-146	MYB34_ARATH; Transcription factor MYB34
TrEMBL	A0A0D3AY34	0.0	A0A0D3AY34_BRAOL; Uncharacterized protein
STRING	Bo2g161170.1	0.0	(Brassica oleracea)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60890.1	1e-142	myb domain protein 34

Publications ? help Back to Top
Grubb CD,Abel S Glucosinolate metabolism and its control. Trends Plant Sci., 2006. 11(2): p. 89-100 [PMID:16406306] De Schutter K, et al. Arabidopsis WEE1 kinase controls cell cycle arrest in response to activation of the DNA integrity checkpoint. Plant Cell, 2007. 19(1): p. 211-25 [PMID:17209125] Kim K,Jiang K,Teng SL,Feldman LJ,Huang H Using biologically interrelated experiments to identify pathway genes in Arabidopsis. Bioinformatics, 2012. 28(6): p. 815-22 [PMID:22271267] Guo R, et al. Jasmonic acid and glucose synergistically modulate the accumulation of glucosinolates in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(18): p. 5707-19 [PMID:24151308] Benstein RM, et al. Arabidopsis phosphoglycerate dehydrogenase1 of the phosphoserine pathway is essential for development and required for ammonium assimilation and tryptophan biosynthesis. Plant Cell, 2013. 25(12): p. 5011-29 [PMID:24368794] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Frerigmann H,Gigolashvili T MYB34, MYB51, and MYB122 distinctly regulate indolic glucosinolate biosynthesis in Arabidopsis thaliana. Mol Plant, 2014. 7(5): p. 814-28 [PMID:24431192] Frerigmann H,Gigolashvili T Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency. Front Plant Sci, 2014. 5: p. 626 [PMID:25426131] Frerigmann H,Glawischnig E,Gigolashvili T The role of MYB34, MYB51 and MYB122 in the regulation of camalexin biosynthesis in Arabidopsis thaliana. Front Plant Sci, 2015. 6: p. 654 [PMID:26379682] Frerigmann H, et al. Regulation of Pathogen-Triggered Tryptophan Metabolism in Arabidopsis thaliana by MYB Transcription Factors and Indole Glucosinolate Conversion Products. Mol Plant, 2016. 9(5): p. 682-695 [PMID:26802248] Stahl E, et al. Regulatory and Functional Aspects of Indolic Metabolism in Plant Systemic Acquired Resistance. Mol Plant, 2016. 9(5): p. 662-681 [PMID:26802249] Bulgakov VP,Veremeichik GN,Grigorchuk VP,Rybin VG,Shkryl YN The rolB gene activates secondary metabolism in Arabidopsis calli via selective activation of genes encoding MYB and bHLH transcription factors. Plant Physiol. Biochem., 2016. 102: p. 70-9 [PMID:26913794] Miao H, et al. Glucose enhances indolic glucosinolate biosynthesis without reducing primary sulfur assimilation. Sci Rep, 2016. 6: p. 31854 [PMID:27549907]