PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013613777.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 76aa MW: 8311.05 Da PI: 11.0921 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 131.4 | 2.4e-41 | 9 | 76 | 3 | 70 |
S1FA 3 vakveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70 +a++ea+GlnPGlivllv+gg+l+vflv+n +lyv+aqknlPP+kkkPvskkklkreklkqGv+vPGe XP_013613777.1 9 KAAAEARGLNPGLIVLLVIGGPLVVFLVANIVLYVHAQKNLPPKKKKPVSKKKLKREKLKQGVSVPGE 76 7899***************************************************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 1.6E-36 | 12 | 76 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MDREDFARKA AAEARGLNPG LIVLLVIGGP LVVFLVANIV LYVHAQKNLP PKKKKPVSKK 60 KLKREKLKQG VSVPGE |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Bol.1036 | 2e-71 | leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013613777.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC189269 | 5e-66 | AC189269.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB023B16, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013613777.1 | 2e-46 | PREDICTED: DNA-binding protein S1FA1-like | ||||
Refseq | XP_013613779.1 | 2e-46 | PREDICTED: DNA-binding protein S1FA1-like | ||||
Refseq | XP_013665799.1 | 2e-46 | DNA-binding protein S1FA1-like | ||||
Refseq | XP_022568689.1 | 2e-46 | DNA-binding protein S1FA1-like | ||||
Swissprot | Q42337 | 1e-18 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
TrEMBL | A0A078H068 | 4e-42 | A0A078H068_BRANA; BnaC04g27370D protein | ||||
STRING | Bo00703s150.1 | 1e-42 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM2823 | 27 | 69 |