PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica

Family

MIKC_MADS

Protein Properties

Length: 211aa MW: 23928.7 Da PI: 8.0472

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_013590486.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	81.8	4.5e-26	9	57	1	49
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 krien rqvtf+kRr+g+lKKA+ELSvLCdaev v+ifs++gkl+e XP_013590486.1 9 KRIENPVHRQVTFCKRRTGLLKKAKELSVLCDAEVGVMIFSPQGKLFEL 57 79********************************************996 PP
2	K-box	58.4	3e-20	100	181	19	100
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100 +++ Lk+ei++Lq+ +R + G + ++++l+eL Le++Le +++iRs K+e++l++i+ l++ e l+++nk+L +k+ee XP_013590486.1 100 DQVNELKQEIDMLQKGIRYMFGGGDGTMNLQELLLLEKHLEYWISHIRSAKMEIMLQEIQSLRNTEGVLKNANKYLLEKIEE 181 6899***************************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	5.0E-37	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.885	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.35E-28	1	76	IPR002100	Transcription factor, MADS-box
CDD	cd00265	1.56E-39	2	78	No hit	No description
PRINTS	PR00404	2.8E-27	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	9.6E-24	10	56	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.8E-27	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.8E-27	38	59	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS51297	12.313	95	185	IPR002487	Transcription factor, K-box
Pfam	PF01486	1.5E-19	99	179	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 211 aa Download sequence Send to blast
MARGKIQLKR IENPVHRQVT FCKRRTGLLK KAKELSVLCD AEVGVMIFSP QGKLFELATK 60 GTMEGMIAKY MKCTGGGRGS SSATFTAQEQ LQPPNLDPKD QVNELKQEID MLQKGIRYMF 120 GGGDGTMNLQ ELLLLEKHLE YWISHIRSAK MEIMLQEIQS LRNTEGVLKN ANKYLLEKIE 180 ENNNSVLDAN FATVETNYSY PLTMPSEIFE F

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	3e-16	1	70	1	69	MEF2C
5f28_B	3e-16	1	70	1	69	MEF2C
5f28_C	3e-16	1	70	1	69	MEF2C
5f28_D	3e-16	1	70	1	69	MEF2C
6byy_A	3e-16	1	70	1	69	MEF2 CHIMERA
6byy_B	3e-16	1	70	1	69	MEF2 CHIMERA
6byy_C	3e-16	1	70	1	69	MEF2 CHIMERA
6byy_D	3e-16	1	70	1	69	MEF2 CHIMERA
6bz1_A	4e-16	1	70	1	69	MEF2 CHIMERA
6bz1_B	4e-16	1	70	1	69	MEF2 CHIMERA
6bz1_C	4e-16	1	70	1	69	MEF2 CHIMERA
6bz1_D	4e-16	1	70	1	69	MEF2 CHIMERA
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During embryo development, expressed in a punctate pattern from the globular stage to the torpedo stage. {ECO:0000269\|PubMed:11855641}.
Uniprot	TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). In root meristem, expressed in external cells of columella, lateral root cap and atrichoblasts. In mature root, expressed in the central cylinder (PubMed:11855641). Expressed in leaf vasculature, young floral meristems and nectaries (PubMed:18203871). {ECO:0000269\|PubMed:11855641, ECO:0000269\|PubMed:18203871, ECO:0000269\|PubMed:7549482}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription activator that regulates root development by controlling cell proliferation in root meristem. May mediate responses to auxin in the root. May act as promoter of the flowering transition through up-regulation of SOC, FT and LFY. {ECO:0000269\|PubMed:18203871}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_013590486.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By auxin in root phloem. {ECO:0000269\|PubMed:18203871}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AK228190	0.0	AK228190.1 Arabidopsis thaliana mRNA for MADS-box protein AGL12, complete cds, clone: RAFL14-63-K22.
GenBank	BT006157	0.0	BT006157.1 Arabidopsis thaliana clone RAFL17-04-C08 (R50439) putative MADS-box protein (At1g71692) mRNA, complete cds.
GenBank	BT008332	0.0	BT008332.1 Arabidopsis thaliana At1g71692 gene, complete cds.
GenBank	BT008524	0.0	BT008524.1 Arabidopsis thaliana clone U50439 putative MADS-box protein (At1g71692) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013590486.1	1e-157	PREDICTED: agamous-like MADS-box protein AGL12
Swissprot	Q38841	1e-135	AGL12_ARATH; Agamous-like MADS-box protein AGL12
TrEMBL	A0A0D3CXA4	1e-156	A0A0D3CXA4_BRAOL; Uncharacterized protein
STRING	Bo6g094120.1	1e-156	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM7052	26	41

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G71692.1	1e-138	AGAMOUS-like 12

Publications ? help Back to Top
Zimmermann P,Hirsch-Hoffmann M,Hennig L,Gruissem W GENEVESTIGATOR. Arabidopsis microarray database and analysis toolbox. Plant Physiol., 2004. 136(1): p. 2621-32 [PMID:15375207] Pacheco-Escobedo MA, et al. Longitudinal zonation pattern in Arabidopsis root tip defined by a multiple structural change algorithm. Ann. Bot., 2018. [PMID:27358290] García-Cruz KV, et al. The MADS-box XAANTAL1 increases proliferation at the Arabidopsis root stem-cell niche and participates in transition to differentiation by regulating cell-cycle components. Ann. Bot., 2018. [PMID:27474508]