![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013590148.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | HD-ZIP | ||||||||
Protein Properties | Length: 178aa MW: 20651.4 Da PI: 6.2878 | ||||||||
Description | HD-ZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 61.3 | 1.5e-19 | 26 | 79 | 3 | 56 |
--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 k++++t eq++ Le+ Fe+++++ e+++eLAk lgL++rqV vWFqNr+a+ k XP_013590148.1 26 KKRRLTVEQVNMLEKSFEEENKLEPERKTELAKMLGLPQRQVAVWFQNRKARCK 79 56689***********************************************98 PP | |||||||
2 | HD-ZIP_I/II | 119.1 | 2.4e-38 | 25 | 115 | 1 | 91 |
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 ekkrrl+ eqv++LE+sFeee+kLeperK+ela+ Lgl +rqvavWFqnr+AR k ++E+dy++Lk++yd+l +++e++ +e+e+L++++ XP_013590148.1 25 EKKRRLTVEQVNMLEKSFEEENKLEPERKTELAKMLGLPQRQVAVWFQNRKARCKIMKIERDYDVLKACYDSLLAKHESVISENEKLKSKV 115 69**************************************************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF46689 | 1.8E-18 | 12 | 81 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50071 | 16.827 | 21 | 81 | IPR001356 | Homeobox domain |
SMART | SM00389 | 7.2E-19 | 24 | 85 | IPR001356 | Homeobox domain |
Pfam | PF00046 | 9.1E-17 | 26 | 79 | IPR001356 | Homeobox domain |
CDD | cd00086 | 1.03E-15 | 26 | 82 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.1E-19 | 27 | 88 | IPR009057 | Homeodomain-like |
PRINTS | PR00031 | 3.1E-6 | 52 | 61 | IPR000047 | Helix-turn-helix motif |
PROSITE pattern | PS00027 | 0 | 56 | 79 | IPR017970 | Homeobox, conserved site |
PRINTS | PR00031 | 3.1E-6 | 61 | 77 | IPR000047 | Helix-turn-helix motif |
Pfam | PF02183 | 7.4E-15 | 83 | 122 | IPR003106 | Leucine zipper, homeobox-associated |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MDPNYDQESR SRSAPTGEID NQPAEKKRRL TVEQVNMLEK SFEEENKLEP ERKTELAKML 60 GLPQRQVAVW FQNRKARCKI MKIERDYDVL KACYDSLLAK HESVISENEK LKSKVFTLTE 120 MLLPAAHQTQ RNLQGKLNSK GDDETMSSST ALVPLANDHY FTNVDETFGW WVWPSNLM |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in seedlings, roots, leaves, nodes, internodes, flowers and embryo. {ECO:0000269|PubMed:10732669, ECO:0000269|PubMed:17999151}. | |||||
Uniprot | TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:16055682}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription activator involved in leaf development. Binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:8535134}. | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:10732669}. | |||||
UniProt | Probable transcription activator that binds to the DNA sequence 5'-CAAT[AT]ATTG-3'. {ECO:0000269|PubMed:10732669}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013590148.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC232548 | 1e-125 | AC232548.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH010J09, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013590148.1 | 1e-132 | PREDICTED: homeobox-leucine zipper protein HAT5-like | ||||
Refseq | XP_013700742.1 | 1e-132 | homeobox-leucine zipper protein HAT5-like | ||||
Refseq | XP_013700743.1 | 1e-132 | homeobox-leucine zipper protein HAT5-like | ||||
Swissprot | Q02283 | 2e-39 | HAT5_ARATH; Homeobox-leucine zipper protein HAT5 | ||||
Swissprot | Q6ZA74 | 6e-39 | HOX5_ORYSJ; Homeobox-leucine zipper protein HOX5 | ||||
Swissprot | Q9XH36 | 6e-39 | HOX5_ORYSI; Homeobox-leucine zipper protein HOX5 | ||||
TrEMBL | A0A0D3CT19 | 1e-130 | A0A0D3CT19_BRAOL; Uncharacterized protein | ||||
TrEMBL | A0A3P6FTP6 | 1e-130 | A0A3P6FTP6_BRAOL; Uncharacterized protein | ||||
STRING | Bo6g064420.1 | 1e-131 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM16382 | 11 | 13 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G01470.1 | 9e-42 | homeobox 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|