PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_013586645.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 164aa MW: 17545.8 Da PI: 8.4902 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 53.9 | 2.5e-17 | 43 | 77 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C+ Cgt TplWR gp g+k+LCnaCG++ rkk + XP_013586645.1 43 CVDCGTFRTPLWRGGPAGPKSLCNACGIKSRKKTQ 77 ********************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 1.9E-12 | 37 | 79 | No hit | No description |
SMART | SM00401 | 4.0E-12 | 37 | 93 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.149 | 37 | 73 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 2.8E-14 | 41 | 76 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 3.89E-10 | 42 | 90 | No hit | No description |
Pfam | PF00320 | 3.7E-15 | 43 | 77 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 43 | 68 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 164 aa Download sequence Send to blast |
MSEGSEETKT KLDSAGESSD VDNENCISSG SGGGSSGETK RTCVDCGTFR TPLWRGGPAG 60 PKSLCNACGI KSRKKTQAAL GIKPEKKIRN SIITSDSSDL SLEDDDDHKT CSSKGMSRFL 120 DLGFKVPVMK RSSVEKKKRL WSKLGEEERA ALLLMALSCA SVYA |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_013586645.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013586645.1 | 1e-115 | PREDICTED: GATA transcription factor 17-like | ||||
Swissprot | Q9LIB5 | 9e-68 | GAT17_ARATH; GATA transcription factor 17 | ||||
TrEMBL | A0A0D3CJG8 | 1e-114 | A0A0D3CJG8_BRAOL; Uncharacterized protein | ||||
STRING | Bo5g123610.1 | 1e-114 | (Brassica oleracea) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM12643 | 15 | 28 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G16870.1 | 4e-52 | GATA transcription factor 17 |
Publications ? help Back to Top | |||
---|---|---|---|
|