PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_012572230.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 159aa MW: 18484.6 Da PI: 9.6 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 91.2 | 8.1e-29 | 102 | 159 | 1 | 58 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 +dDgy+WrKYG+K+vk++++ r+YY+C+s gC+vkk+ver+++d ++v++tYeg Hnh XP_012572230.1 102 MDDGYKWRKYGKKSVKNNPNLRNYYKCSSLGCNVKKRVERDRDDSSYVITTYEGVHNH 159 69*******************************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 3.0E-31 | 90 | 159 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.22E-26 | 94 | 159 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 29.287 | 97 | 159 | IPR003657 | WRKY domain |
SMART | SM00774 | 8.5E-30 | 102 | 159 | IPR003657 | WRKY domain |
Pfam | PF03106 | 7.3E-23 | 103 | 159 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 159 aa Download sequence Send to blast |
MDYNFVNPHP NPNFVHSTHM VPSSPHFILS DYLRLDDIFI DQESHSQSIE SLYKVTFSHA 60 NQGSNHATSK NNNIKYKNGI KRNKGEVGPN IAFRTRSELE IMDDGYKWRK YGKKSVKNNP 120 NLRNYYKCSS LGCNVKKRVE RDRDDSSYVI TTYEGVHNH |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 4e-24 | 92 | 159 | 7 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 4e-24 | 92 | 159 | 7 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). Involved in defense responses. May act as positive regulator of salicylic acid (SA)-mediated signaling and negative regulator of jasmonic acid (JA)-mediated signaling (PubMed:21030507). {ECO:0000250, ECO:0000269|PubMed:21030507}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_012572230.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012572230.1 | 1e-116 | probable WRKY transcription factor 51 | ||||
Swissprot | Q93WU9 | 2e-40 | WRK51_ARATH; Probable WRKY transcription factor 51 | ||||
TrEMBL | A0A1S3E8T7 | 1e-115 | A0A1S3E8T7_CICAR; probable WRKY transcription factor 51 | ||||
STRING | AET04594 | 8e-88 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1120 | 34 | 110 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64810.1 | 1e-40 | WRKY DNA-binding protein 51 |
Publications ? help Back to Top | |||
---|---|---|---|
|