PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

XP_012567363.1

Organism

Cicer arietinum

Taxonomic ID

3827

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer

Family

HB-other

Protein Properties

Length: 193aa MW: 21647.2 Da PI: 8.0924

Description

HB-other family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
XP_012567363.1	genome	NCBI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	24.1	6.2e-08	7	38	23	54
SS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS Homeobox 23 rypsaeereeLAkklgLterqVkvWFqNrRak 54 +y+ +++ LAk++gL+ +qV++WF N R + XP_012567363.1 7 NYLIDTDKIMLAKQTGLSRNQVSNWFINARVR 38 6888889999********************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50071	9.961	1	42	IPR001356	Homeobox domain
SuperFamily	SSF46689	1.37E-10	7	49	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	1.8E-15	8	46	IPR009057	Homeodomain-like
CDD	cd00086	2.95E-8	8	43	No hit	No description
Pfam	PF05920	6.0E-11	12	38	IPR008422	Homeobox KN domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 193 aa Download sequence Send to blast
MSCKFSNYLI DTDKIMLAKQ TGLSRNQVSN WFINARVRLW KPMVEEIHML ESQQTQKEPQ 60 RDENPSTSTD KFQLRSNNNI AENPCNSTDK FHNVAYKRTR NELSNMSVLN QQVGSNGVSM 120 GSNVATSNNG VSLTLGLHQN HGIGLSEPFN MSVAQCFGLA LQPDSYVMST FQSQNRQFGR 180 DLIGGQILHD FVG

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that is involved in the preservation of the spiral phyllotactic arrangement leading to a regular pattern of organ initiation. Required for maintenance of stem cell fate in the shoot apical meristem, and is essential for specifying floral primordia and establishing early internode patterning events during inflorescence development. Acts as transcription repressor of AG expression in floral and inflorescence meristems. Is also responsive of the nuclear import of SHOOT MERISTEMLESS (STM). In the fruit, plays a central role in patterning by negatively regulating SHP expression in order to prevent replum cells from adopting a valve margin cell fate. {ECO:0000269\|PubMed:12874117, ECO:0000269\|PubMed:12897247, ECO:0000269\|PubMed:13678595, ECO:0000269\|PubMed:15019989, ECO:0000269\|PubMed:15120075, ECO:0000269\|PubMed:15155890, ECO:0000269\|PubMed:16741748}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	XP_012567363.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_004515686.1	1e-143	BEL1-like homeodomain protein 9 isoform X1
Refseq	XP_012567363.1	1e-143	BEL1-like homeodomain protein 9 isoform X1
Refseq	XP_027186728.1	1e-143	BEL1-like homeodomain protein 9 isoform X1
Refseq	XP_027186729.1	1e-143	BEL1-like homeodomain protein 9 isoform X1
Swissprot	Q9LZM8	3e-37	BLH9_ARATH; BEL1-like homeodomain protein 9
TrEMBL	A0A1S3DVW3	1e-142	A0A1S3DVW3_CICAR; BEL1-like homeodomain protein 9 isoform X1
STRING	XP_004515686.1	1e-143	(Cicer arietinum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G02030.1	1e-39	TALE family protein

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Pabón-Mora N,Wong GK,Ambrose BA Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] Khan M, et al. Repression of Lateral Organ Boundary Genes by PENNYWISE and POUND-FOOLISH Is Essential for Meristem Maintenance and Flowering in Arabidopsis. Plant Physiol., 2015. 169(3): p. 2166-86 [PMID:26417006] Andrés F, et al. Floral Induction in Arabidopsis by FLOWERING LOCUS T Requires Direct Repression of BLADE-ON-PETIOLE Genes by the Homeodomain Protein PENNYWISE. Plant Physiol., 2015. 169(3): p. 2187-99 [PMID:26417007] Bencivenga S,Serrano-Mislata A,Bush M,Fox S,Sablowski R Control of Oriented Tissue Growth through Repression of Organ Boundary Genes Promotes Stem Morphogenesis. Dev. Cell, 2016. 39(2): p. 198-208 [PMID:27666746] Sehra B,Franks RG Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] Simonini S,Stephenson P,Østergaard L A molecular framework controlling style morphology in Brassicaceae. Development, 2018. [PMID:29440299]