![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011396693.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Chlorellales; Chlorellaceae; Auxenochlorella
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 97aa MW: 10501.9 Da PI: 10.4727 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55.4 | 8.3e-18 | 18 | 51 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 Cs+Cg+t++p+WRrgp ++ LCnaCG +yr+++ XP_011396693.1 18 CSHCGVTESPQWRRGPAHKPLLCNACGTRYRRTN 51 ****************98888**********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 3.1E-11 | 12 | 64 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 12.519 | 12 | 65 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 8.08E-15 | 15 | 64 | No hit | No description |
CDD | cd00202 | 2.05E-15 | 17 | 57 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 1.1E-13 | 17 | 56 | IPR013088 | Zinc finger, NHR/GATA-type |
Pfam | PF00320 | 1.6E-15 | 18 | 51 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 97 aa Download sequence Send to blast |
MSLQEILASR AAFGGPSCSH CGVTESPQWR RGPAHKPLLC NACGTRYRRT NQFLPLHATP 60 GSRKRATSAP QTCAQENALE DKAHTGFKQP RLIASTA |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011396693.1 | 1e-66 | GATA transcription factor 26 | ||||
TrEMBL | A0A087SDL1 | 3e-65 | A0A087SDL1_AUXPR; GATA transcription factor 26 | ||||
STRING | A0A087SDL1 | 5e-66 | (Auxenochlorella protothecoides) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Chlorophytae | OGCP450 | 15 | 26 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G17570.3 | 1e-13 | GATA transcription factor 26 |
Link Out ? help Back to Top | |
---|---|
Entrez Gene | 23618174 |