![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_011075275.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 188aa MW: 22167.5 Da PI: 10.1445 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 121.9 | 5.6e-38 | 26 | 154 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv.ePwdLpkkvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lp+Gf+F+ td el+ yL kk+++++l+l + i+evd+y++ P+ L +++k +ek+wyfF++r +kya+g+r+ r t gyWk+tg d +v XP_011075275.1 26 LPQGFKFRRTDLELLEAYLIKKLKNQPLPL-NRIREVDLYSFaTPQALTANIKLiREKKWYFFTPRFRKYANGDRPDRGTPGGYWKTTGADIKVR 119 799***************************.77*******9878****9655544889************************************* PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128 ++ g + g+k+tL f++g+ gekt+W+mhey + XP_011075275.1 120 NHVGLVLGTKRTLCFHEGKPMAGEKTNWIMHEYIV 154 *9999****************************75 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 2.09E-45 | 23 | 178 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 44.335 | 26 | 178 | IPR003441 | NAC domain |
Pfam | PF02365 | 7.6E-20 | 27 | 153 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 188 aa Download sequence Send to blast |
MERKGKEKEI ESDWIYNSED EYFSSLPQGF KFRRTDLELL EAYLIKKLKN QPLPLNRIRE 60 VDLYSFATPQ ALTANIKLIR EKKWYFFTPR FRKYANGDRP DRGTPGGYWK TTGADIKVRN 120 HVGLVLGTKR TLCFHEGKPM AGEKTNWIMH EYIVDRPTTP HNKPRKLDEW VLCKVFLRNV 180 GQKKDDSA |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-39 | 25 | 184 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-39 | 25 | 184 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-39 | 25 | 184 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-39 | 25 | 184 | 16 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
3swm_B | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
3swm_C | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
3swm_D | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
3swp_A | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
3swp_B | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
3swp_C | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
3swp_D | 3e-39 | 25 | 184 | 19 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-39 | 25 | 184 | 16 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-39 | 25 | 184 | 16 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in abscisic acid-mediated stomatal closure (PubMed:25005917). Regulates the expression of NCED1, a gene involved in the biosynthesis of abscisic acid (ABA) (PubMed:25005917). Required for the stomatal closure induced by the bacterial pathogen Pseudomonas syringae pv tomato DC3000, but not for stomatal reopening (PubMed:25005917). {ECO:0000269|PubMed:25005917}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | XP_011075275.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by abscisic acid (ABA), dehydration and wounding. {ECO:0000269|PubMed:25005917}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011075275.1 | 1e-139 | NAC transcription factor 32-like | ||||
Swissprot | Q9SQL0 | 3e-40 | JA2_SOLLC; NAC domain-containing protein JA2 | ||||
TrEMBL | A0A2G9GNE4 | 3e-63 | A0A2G9GNE4_9LAMI; Uncharacterized protein | ||||
STRING | EOY09270 | 9e-46 | (Theobroma cacao) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G04070.2 | 5e-41 | NAC domain containing protein 47 |
Publications ? help Back to Top | |||
---|---|---|---|
|